Protein Info for HSERO_RS15125 in Herbaspirillum seropedicae SmR1

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 555 PF08447: PAS_3" amino acids 148 to 236 (89 residues), 81.7 bits, see alignment E=9.3e-27 amino acids 282 to 364 (83 residues), 48.6 bits, see alignment E=2e-16 TIGR00229: PAS domain S-box protein" amino acids 148 to 250 (103 residues), 37.8 bits, see alignment E=1.9e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 381 to 546 (166 residues), 169 bits, see alignment E=7.2e-54 PF00990: GGDEF" amino acids 385 to 543 (159 residues), 161 bits, see alignment E=5.3e-51

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_3014)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J0E6 at UniProt or InterPro

Protein Sequence (555 amino acids)

>HSERO_RS15125 diguanylate cyclase (Herbaspirillum seropedicae SmR1)
IFLYDDQARRMQAGAVPYMAPALVAQIQDLPAEAADTPDVWQRFDELAGRHGVRLAEMLP
LRSFAGQLAGLMMIAATDADSGFEEDQAYRQTVSAAVSMAMLAIERALVPGHVLTPRDAP
DQAYERMALAIEGSGTGIWDRNAVTGEMYYSRGWKAILGYEDWELSSHLADAYQRIHPDD
LAYVQQTIRQHFEARSDHYEVEHRIRCQDGSYKWISSRGKVVARDAQGNALRMIGTTTDI
TEIKRLTEKLGKSSRMLDYLTSEIPGMVFQFKVPPGAPGYFTYVSEGARETYGLTPQQLL
ENPAIIDTVIHPDDMPLYEAAREAVLGGAAHWTLEFRVLPPGQGVRWLRGQSRPRRLDDG
TTLWHGFISDISQSKAIELELQEFALTDYLTQLPNRRYFMQRLQEEYSRIQRSVTAGAAV
LMCDLDHFKRINDSLGHAVGDLVLRHFATVLKSQLRRSDTAGRLGGEEFAIILTGADQQA
AADFAARLQNRFAGQPLIHDEREVKVTLSIGVALMQADSAGQEQVLRASDDALYRAKEKG
RNRVEFAPFGSARSG