Protein Info for HSERO_RS14925 in Herbaspirillum seropedicae SmR1

Annotation: malate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR01759: malate dehydrogenase" amino acids 4 to 323 (320 residues), 478.4 bits, see alignment E=4.8e-148 PF00056: Ldh_1_N" amino acids 6 to 155 (150 residues), 124.6 bits, see alignment E=3.2e-40 PF02866: Ldh_1_C" amino acids 160 to 326 (167 residues), 130.3 bits, see alignment E=7.9e-42

Best Hits

Swiss-Prot: 92% identical to MDH_JANMA: Malate dehydrogenase (mdh) from Janthinobacterium sp. (strain Marseille)

KEGG orthology group: K00024, malate dehydrogenase [EC: 1.1.1.37] (inferred from 100% identity to hse:Hsero_2976)

MetaCyc: 60% identical to malate dehydrogenase (Mycobacterium tuberculosis H37Rv)
Malate dehydrogenase. [EC: 1.1.1.37, 1.1.1.38]

Predicted SEED Role

"Malate dehydrogenase (EC 1.1.1.37)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 1.1.1.37)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.37

Use Curated BLAST to search for 1.1.1.37 or 1.1.1.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IZX4 at UniProt or InterPro

Protein Sequence (329 amino acids)

>HSERO_RS14925 malate dehydrogenase (Herbaspirillum seropedicae SmR1)
MAKAPMRVAVTGAAGQIGYSLLFRIANGDLLGKDQPVILQLLEIPDEKAQKALKGVIMEI
DDCAFPLLAGVTAHSDPMTAFKDADIALLVGARPRGPGMERKDLLEANAQIFTVQGKALD
AVASRNVKVLVVGNPANTNAYIAMKSAPNLPAKNFTAMLRLDHNRALSQVAAKIGKPVSA
IEKLCVWGNHSPTMYADYRFATADGVSVKDTINDQEWNKNVFLPTVGKRGAAIIEARGLS
SAASAANAAIDHVRDWVLGTNGKWTTMGIPSDGSYGIPEGTMFGFPVTTENGEYKIVQGL
EIDEFSQERINITLKELMEEREGVKHLVG