Protein Info for HSERO_RS14825 in Herbaspirillum seropedicae SmR1

Annotation: 23S rRNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 PF05958: tRNA_U5-meth_tr" amino acids 272 to 445 (174 residues), 54.1 bits, see alignment E=2.8e-18 PF02475: Met_10" amino acids 294 to 355 (62 residues), 21.2 bits, see alignment E=4.4e-08

Best Hits

Swiss-Prot: 70% identical to RLMD_CUPNH: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (rlmD) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 100% identity to hse:Hsero_2958)

Predicted SEED Role

"23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IZV6 at UniProt or InterPro

Protein Sequence (453 amino acids)

>HSERO_RS14825 23S rRNA methyltransferase (Herbaspirillum seropedicae SmR1)
MQQDIIIEIKSLDMDGRGVGHLENEDGTQGKVIFVEGALPGERVSFQSYRKKPKWEAGVM
TTLHSESSLRVKPRCDYFGTCGGCAMQHLEPSAQVAMKQRVLEDNLWHLGKTKAEVMLRP
IYGPTWGYRYRARISVRHVAKKGGVLVGFHEKRSSFIADMKTCEILPPNVSAMLVPLREL
VAGLSIRDRMPQIELAVGEGDDGNKVTVLVLRIMEALSPADEVLLKSFADEHKIEWWLQT
KGPDTAAPYYPAQSRLQYTLPEFGIRMPFKPTDFTQVNHQINRVLVARALRLLDVQPQDR
VADLFCGLGNFTLPIATLAREVVGIEGSTALTERALDNAKVNGVDAKTSFYCRNLFEAKP
EDFVALGKFDRMLIDPPREGAMEVCKALVELPPEQQHLKPKRIVYVSCNPATLARDAGML
VHLGGYALKYAGVVNMFPHTAHVESIAVFDLPE