Protein Info for HSERO_RS14780 in Herbaspirillum seropedicae SmR1

Annotation: ribosome-associated GTPase EngA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 TIGR03594: ribosome-associated GTPase EngA" amino acids 3 to 436 (434 residues), 575.4 bits, see alignment E=1.2e-176 TIGR00231: small GTP-binding protein domain" amino acids 4 to 156 (153 residues), 68.2 bits, see alignment E=1.1e-22 amino acids 181 to 344 (164 residues), 88.3 bits, see alignment E=7.4e-29 PF02421: FeoB_N" amino acids 5 to 156 (152 residues), 45.7 bits, see alignment E=3.1e-15 amino acids 182 to 344 (163 residues), 45 bits, see alignment E=5e-15 PF01926: MMR_HSR1" amino acids 5 to 120 (116 residues), 98.4 bits, see alignment E=1.7e-31 amino acids 182 to 300 (119 residues), 92.8 bits, see alignment E=9.4e-30 PF00009: GTP_EFTU" amino acids 213 to 349 (137 residues), 35.6 bits, see alignment E=4.4e-12 PF14714: KH_dom-like" amino acids 356 to 436 (81 residues), 92.1 bits, see alignment E=1.3e-29

Best Hits

Swiss-Prot: 88% identical to DER_JANMA: GTPase Der (der) from Janthinobacterium sp. (strain Marseille)

KEGG orthology group: K03977, GTP-binding protein (inferred from 100% identity to hse:Hsero_2949)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IZU7 at UniProt or InterPro

Protein Sequence (447 amino acids)

>HSERO_RS14780 ribosome-associated GTPase EngA (Herbaspirillum seropedicae SmR1)
MKPVIALVGRPNVGKSTLFNRLTRSRDALVADLPGLTRDRHYGEGRVGERPFLVIDTGGF
EPVAKDGIMYEMAKQTKQAVVEADVVVFIVDGRQGLTPHDKTITDFLRKCGRPVLLVVNK
SEGMKYTSVTADFYELGMGDPYVISAAHGDGVADLVTEALDVAEAQRTPEPEPEETAVRG
TKIAIVGRPNVGKSTLVNTLLGEERVIAFDMPGTTRDSIEIPFEREGRHYTLIDTAGIRR
RGKVFEAIEKFSVVKTLKSISDANVVLLLLDAQQDISEQDAHIAGFVLESGRALVVGVNK
WDGMESDQRNQIKMDLERKLNFLSFAKFHFISALKSTGIGPLMKSIDSAYAAAMAKLSTP
RLTRALEEALEHQQPRRKGSIRPKLRYAHQGGQNPPVVVIHGNALEAIDDNYKRYLEKHF
RETFSLVGTPLRIEFRSGKNPFIRQEK