Protein Info for HSERO_RS14545 in Herbaspirillum seropedicae SmR1

Annotation: nitrite reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 PF07992: Pyr_redox_2" amino acids 13 to 291 (279 residues), 208 bits, see alignment E=8.5e-65 PF13738: Pyr_redox_3" amino acids 82 to 284 (203 residues), 38.8 bits, see alignment E=2.8e-13 PF00070: Pyr_redox" amino acids 155 to 235 (81 residues), 69.3 bits, see alignment E=1.3e-22 PF18267: Rubredoxin_C" amino acids 325 to 392 (68 residues), 65.2 bits, see alignment E=1.7e-21

Best Hits

KEGG orthology group: K00362, nitrite reductase (NAD(P)H) large subunit [EC: 1.7.1.4] (inferred from 100% identity to hse:Hsero_2899)

Predicted SEED Role

"Nitrite reductase [NAD(P)H] large subunit (EC 1.7.1.4)" in subsystem Nitrate and nitrite ammonification (EC 1.7.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.1.4

Use Curated BLAST to search for 1.7.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IZQ1 at UniProt or InterPro

Protein Sequence (407 amino acids)

>HSERO_RS14545 nitrite reductase (Herbaspirillum seropedicae SmR1)
METQANKSTARPSLVVVGNGMAGMRTVEELLKLAPDLYDITVFGAEPHGNYNRIMLSPVL
AGDKSIDDIMLNPRAWYDDNGITLHAGDPVVHIDRRQRTVHAKSGLTVQYDRLLLATGST
PFIIPVPGHQLPGVIAFRDIQDVDAMLQAARTHRHAVVIGGGLLGLEAANGLMRQGMDVT
VVHVTDALMNQQLDKPAAALLKKALEDKGLRFLLNAHTEEIVGPDRVTAVRFKDGSSIPA
DLVVMTAGVRPNIALAKAAGLHCERAIIVDDTLQTYDPRVYAVGECVQHRKATFGLVAPI
WDQARVCGAHLAGAGHRRYVQQATATKLKVTGVDLYSAGDFIGGDDTEDLIVRDPRRGVY
KRLVLRGTRLVGAVLYGDVKDGPWYFDLIQSGRDISSFRRELPFGQA