Protein Info for HSERO_RS14455 in Herbaspirillum seropedicae SmR1

Annotation: peptidase C39

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 726 transmembrane" amino acids 166 to 186 (21 residues), see Phobius details amino acids 196 to 220 (25 residues), see Phobius details amino acids 274 to 298 (25 residues), see Phobius details amino acids 304 to 324 (21 residues), see Phobius details amino acids 369 to 386 (18 residues), see Phobius details amino acids 392 to 410 (19 residues), see Phobius details amino acids 421 to 437 (17 residues), see Phobius details PF03412: Peptidase_C39" amino acids 14 to 138 (125 residues), 59.1 bits, see alignment E=6.5e-20 TIGR01846: type I secretion system ATPase" amino acids 16 to 716 (701 residues), 978.2 bits, see alignment E=1.1e-298 PF00664: ABC_membrane" amino acids 166 to 431 (266 residues), 194.2 bits, see alignment E=5.8e-61 PF00005: ABC_tran" amino acids 495 to 643 (149 residues), 114.9 bits, see alignment E=6.9e-37

Best Hits

Swiss-Prot: 63% identical to CYAB_BORP1: Cyclolysin secretion/processing ATP-binding protein CyaB (cyaB) from Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323)

KEGG orthology group: K11004, ATP-binding cassette, subfamily B, bacterial HlyB/CyaB (inferred from 100% identity to hse:Hsero_2881)

Predicted SEED Role

"cyclolysin secretion ATP-binding protein" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IZN3 at UniProt or InterPro

Protein Sequence (726 amino acids)

>HSERO_RS14455 peptidase C39 (Herbaspirillum seropedicae SmR1)
MNETDKDHPPADIDSGLQCLMMMARLHGIAADAQQLQHRFGRQPFEMQTILLAARVLGMT
AKCLHQQRERLERTPLPAIGIDRNGRFFVLAKVEQAQGESAHGQRILVQQPGQAPQVLSQ
RDFEALWSGQVILFTSKASYAQESSRFDFSWFIPAVVKYRKTLAEVLLISLVLQLIGLIT
PMFFQVVMDKVLVNHAMMTLNVIAVGLIAATVFEAVLTGIRTAIFANASSKIDVELGSRL
FSHLLSLPLSYFQVRRAGDSIARVRELENIRSFLTGNAMTLVLDIMFSFVFLGVMLWYSV
SLSLIVLASIPVYVLLSLVFTPLLRERLNDKFNKSAENQSFLVETLTGMDTVKAMAVEPR
WQQKWDKQLAAYVAAGLTTTNISLLASGAVGLVSKLVTVGIMWLGALLVVKNEMSVGELV
AFNMLAGQVASPILRLAQLWNDFQQIGISMSRLADVLDARTEVAGNRTRLPRVNGAISFD
LVSFRYRPETPEVIRGLSLQIRPGEVIGIVGRSGSGKSTLAKLVQRLYICETGRISVDGQ
DIAIIDTASLRQQIGVVLQENTLFSRSIRDNIALADPSTPIEQIIEAAKLAGAHDFICEL
PEGYDTMVGEQGSGLSGGQRQRIAIARALITNPGILIFDEATSALDYESEKIIQDNMRQI
CAGRTVLIIAHRLSAVRDADRIIVMERGRVAESGSHDELIDLPGGIYAHLHRLQAGHAGL
IEERTA