Protein Info for HSERO_RS14450 in Herbaspirillum seropedicae SmR1

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 61 to 80 (20 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 56 to 447 (392 residues), 328.2 bits, see alignment E=4.1e-102 PF00529: CusB_dom_1" amino acids 80 to 403 (324 residues), 36.7 bits, see alignment E=6.7e-13 PF13533: Biotin_lipoyl_2" amino acids 109 to 141 (33 residues), 25.4 bits, see alignment (E = 1.9e-09) PF13437: HlyD_3" amino acids 299 to 399 (101 residues), 61.9 bits, see alignment E=1.8e-20

Best Hits

Swiss-Prot: 43% identical to CYAD_BORPE: Protein CyaD (cyaD) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K11003, hemolysin D (inferred from 100% identity to hse:Hsero_2880)

Predicted SEED Role

"HlyD family secretion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IZN2 at UniProt or InterPro

Protein Sequence (447 amino acids)

>HSERO_RS14450 membrane protein (Herbaspirillum seropedicae SmR1)
MSLRHRWQAWTDLWRRYLRVFGHAWRQRGHYRSDFFNKDEAEFLPAALSLQEAPDSRSLR
WTARLLVGMVIFALLWSLLGRIDIVVSANGKVIPSARTKTIASVDVSAVRAILVSEGQLV
KAGEVLIELDSSSSDAERDKAADAVAQARLQAARAQAMMEAIQNLRTPELAQVPGVAQAQ
WEAVRSQLVAQYQDFRARLGRLDDEISRYGAALKLATQRASDYQTLVADHTVSRHAWLEK
EQARVDLQGQLDDARNQRATLVAQTRKDAHDSRIEADKTIEASQQDQRRADEHSKLLKLV
APVTGTVQQLTVHTIGGVVPAAQPLMQIVPQDSQIEVEAMLENKDVGFVEIGQAAEVKID
AFDYTKYGTLPARVVHISRDAIQDEKKGLLYSARIVLDQSSLIVDGRKVQLSAGMAANVE
IKTGNRRVIEYALSPLIRHQKEALHER