Protein Info for HSERO_RS14060 in Herbaspirillum seropedicae SmR1

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 PF13452: MaoC_dehydrat_N" amino acids 79 to 138 (60 residues), 27.7 bits, see alignment E=1.4e-10

Best Hits

Swiss-Prot: 48% identical to MEH_CHLAA: Mesaconyl-C(4)-CoA hydratase (meh) from Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)

KEGG orthology group: K09709, mesaconyl-C4 CoA hydratase (inferred from 100% identity to hse:Hsero_2799)

MetaCyc: 48% identical to mesaconyl-C4-CoA hydratase monomer (Chloroflexus aurantiacus)
RXN-8965 [EC: 4.2.1.153]

Predicted SEED Role

"COGs COG3777"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.153

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IYV9 at UniProt or InterPro

Protein Sequence (286 amino acids)

>HSERO_RS14060 acyl-CoA dehydrogenase (Herbaspirillum seropedicae SmR1)
MASPDLDLTLLRQWLDKSETRHDHLHPAMASALAATLDGPRQPLAGEGLPPLWHWIYFWN
ACRQSETGPDGHPLRGGFLPPVPLPRRMWAGGRLRFMAPLPIGMEASKHSRVASIDVKQG
RSGALAFVTVHHTISHAGQTCLTEEHDIVYRDLPQAGAAPVPAKAAPTDALWSRRIVPDP
VLLFRYSALTFNGHRIHYDRSYVTGVEGYPGLIVHGPLIATLLADLLARQMPQAVLRAFD
FRAVGSLFDTEAFTLCGKPSADGRRVALWAQNERGELAMQAEATLE