Protein Info for HSERO_RS13790 in Herbaspirillum seropedicae SmR1

Annotation: glycosyl transferase group 1 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 TIGR03088: sugar transferase, PEP-CTERM/EpsH1 system associated" amino acids 1 to 369 (369 residues), 476.8 bits, see alignment E=2.4e-147 PF13439: Glyco_transf_4" amino acids 10 to 170 (161 residues), 77.4 bits, see alignment E=3.4e-25 PF13579: Glyco_trans_4_4" amino acids 11 to 165 (155 residues), 60 bits, see alignment E=9.5e-20 PF00534: Glycos_transf_1" amino acids 191 to 344 (154 residues), 98.9 bits, see alignment E=6.3e-32 PF13692: Glyco_trans_1_4" amino acids 191 to 333 (143 residues), 99.8 bits, see alignment E=4e-32 PF13524: Glyco_trans_1_2" amino acids 275 to 360 (86 residues), 47.6 bits, see alignment E=3.9e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_2748)

Predicted SEED Role

"FIG040338: Glycosyl transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IYQ9 at UniProt or InterPro

Protein Sequence (381 amino acids)

>HSERO_RS13790 glycosyl transferase group 1 protein (Herbaspirillum seropedicae SmR1)
VVHLIYRLDFGGLETLLVDCINRMPAQRYRHAIICLTDYTDFARKIDKADVAIHALHKPP
GLAPQTHLQLWRLLRRLRPDVLHTYNLPTIEYAPAAWLAGVPVRVHGEHGRDARDPHGRN
ARHNLLRRLVLPFYDCYYAVSADLRDWLRDTIKVPADKNLLLANGVDTARFHPPADGQRE
ATPELPAGCMVFGAVGRVQDVKDHATLVNAFIALLAMRPQQRARLRLAIVGEGPLLPALR
AQVQAAGIADLVWLPGARMDVEVMMRRFSVFMLSSIAEGVPVTILEAMATGLPVISTAVG
GVPEVVTEGATGQLTPAGDAAALARAMAAYVDDPALAARHGAAGLERCRRQHSMAAMLQA
YAGMYDRMLAGKRGQSTVQGH