Protein Info for HSERO_RS13615 in Herbaspirillum seropedicae SmR1

Annotation: alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02818: S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase
  • amino acids 2 to 368 (367 residues), 628.2 bits, E=2.2e-193
• PF08240: ADH_N
  • amino acids 28 to 149 (122 residues), 82.3 bits, E=3.3e-27
• PF00107: ADH_zinc_N
  • amino acids 197 to 328 (132 residues), 102.4 bits, E=2.8e-33
• PF13602: ADH_zinc_N_2
  • amino acids 235 to 361 (127 residues), 27.2 bits, E=1.1e-09

Best Hits

Swiss-Prot: 74% identical to ADHI_RHOS4: Alcohol dehydrogenase class-3 (adhI) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K00121, S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC: 1.1.1.1 1.1.1.284] (inferred from 100% identity to hse:Hsero_2713)

MetaCyc: 74% identical to FlhA (Paracoccus denitrificans)
S-(hydroxymethyl)glutathione dehydrogenase. [EC: 1.1.1.284]

Predicted SEED Role

"S-(hydroxymethyl)glutathione dehydrogenase (EC 1.1.1.284)" in subsystem Glutathione-dependent pathway of formaldehyde detoxification (EC 1.1.1.284)

MetaCyc Pathways

• superpathway of anaerobic sucrose degradation (15/19 steps found)
• heterolactic fermentation (14/18 steps found)
• 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
• ethanol degradation II (3/3 steps found)
• formaldehyde oxidation II (glutathione-dependent) (3/3 steps found)
• mixed acid fermentation (12/16 steps found)
• ethanolamine utilization (4/5 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• acetaldehyde biosynthesis I (1/1 steps found)
• phytol degradation (3/4 steps found)
• L-isoleucine degradation II (2/3 steps found)
• L-leucine degradation III (2/3 steps found)
• L-valine degradation II (2/3 steps found)
• ethanol degradation I (1/2 steps found)
• pyruvate fermentation to ethanol II (1/2 steps found)
• (S)-propane-1,2-diol degradation (3/5 steps found)
• acetylene degradation (anaerobic) (3/5 steps found)
• protein S-nitrosylation and denitrosylation (3/5 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (13/19 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• L-phenylalanine degradation III (2/4 steps found)
• L-tyrosine degradation III (2/4 steps found)
• salidroside biosynthesis (2/4 steps found)
• L-methionine degradation III (1/3 steps found)
• pyruvate fermentation to ethanol I (1/3 steps found)
• pyruvate fermentation to ethanol III (1/3 steps found)
• phenylethanol biosynthesis (2/5 steps found)
• serotonin degradation (3/7 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (4/9 steps found)
• butanol and isobutanol biosynthesis (engineered) (2/8 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (5/13 steps found)
• superpathway of C1 compounds oxidation to CO₂ (4/12 steps found)
• noradrenaline and adrenaline degradation (4/13 steps found)
• L-tryptophan degradation V (side chain pathway) (1/13 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Drug metabolism - cytochrome P450
• Fatty acid metabolism
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Metabolism of xenobiotics by cytochrome P450
• Methane metabolism
• Retinol metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1 or 1.1.1.284

Sequence Analysis Tools

See D8IYM4 at UniProt or InterPro

Protein Sequence (368 amino acids)

>HSERO_RS13615 alcohol dehydrogenase (Herbaspirillum seropedicae SmR1)
MKTRAAVAWQAGKPLTIEEVELGGPKAGEVLVEIKATGICHTDYYTLSGADPEGIFPAIL
GHEGAGVVVDVGPGVKSLKKDDHVIPLYTPECRECKFCLSQKTNLCQAIRATQGRGLMPD
ATSRFSLDGKPLFHYMGTSTFSNYIVVPEIALAKIRSDAPFDKVCYIGCGVTTGVGAVLF
TAKVEAGANVVVFGLGGIGLNVIQAAKMVGANKIIGVDLNPAREAMARKFGMTDFINPKD
VPNVVDAIIGMTDGGADYSFECIGNTTTMRQSLECCHKGWGQSIIIGVAAAGQEISTRPF
QLVTGRVWKGSAFGGARGRTDVPKIVDWYMEGKLNIDDLITHKLPLERINEGFDLMKSGE
SIRSVVEF