Protein Info for HSERO_RS13575 in Herbaspirillum seropedicae SmR1

Annotation: DSBA oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 524 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 90 to 114 (25 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 211 to 230 (20 residues), see Phobius details amino acids 240 to 260 (21 residues), see Phobius details amino acids 280 to 304 (25 residues), see Phobius details amino acids 317 to 338 (22 residues), see Phobius details amino acids 346 to 362 (17 residues), see Phobius details amino acids 374 to 397 (24 residues), see Phobius details amino acids 408 to 428 (21 residues), see Phobius details amino acids 490 to 508 (19 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 26 to 506 (481 residues), 491.4 bits, see alignment E=1.5e-151 PF06609: TRI12" amino acids 28 to 304 (277 residues), 34.4 bits, see alignment E=9.4e-13 PF07690: MFS_1" amino acids 30 to 423 (394 residues), 168.6 bits, see alignment E=1.9e-53

Best Hits

Swiss-Prot: 52% identical to FARB_NEIGO: Fatty acid resistance protein FarB (farB) from Neisseria gonorrhoeae

KEGG orthology group: K03446, MFS transporter, DHA2 family, multidrug resistance protein B (inferred from 100% identity to hse:Hsero_2705)

MetaCyc: 48% identical to tripartite efflux pump membrane subunit EmrY (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-365

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IXU9 at UniProt or InterPro

Protein Sequence (524 amino acids)

>HSERO_RS13575 DSBA oxidoreductase (Herbaspirillum seropedicae SmR1)
MATSPTPSQAYTPPPPLTGANLVLGTLSVSLAVFMNVLDSSIANVAIPTISGNLGVSVDE
GTWVITSFAAANAISIPLTGWLTQRLGAVRLFVTSVLLFVLASWLCGLAPTLPILLAARV
LQGLVAGPMVPLSQSLLLGAYPKSKSSFALALWGMTAVVAPVAGPALGGWITDSYTWPWI
FYINIPVGLIAAGVTLAIYRSRETPTHKLPIDKIGLALLVTWVAAFQIMLDKGKDLDWFA
SPTIVTLGIIALIAFAYFVVWELNNDHPVVDLRLFGRRNFAGGTIAISIGYGVFFGNLVI
LPQWLQQYLGYRSIDSGLSTAPIGIFAVILMPLIGRFLPLVDARKVATASFIGFAIVFWL
RSRYNLQVDQMTVILPTLLQGIPTAMFFVPLTVLLLSGLPPERIPAAAGLSSFVRVFCGA
VGTSISTTAWNNRSIMHHAQLTEHATPYSPWLQETVNNLSSTLGLNAEQTAGMLERTITF
QAAMLGINDIFYVSAVIFIVIIPLIWIIKPSKGGAGAAEASAAH