Protein Info for HSERO_RS13105 in Herbaspirillum seropedicae SmR1

Annotation: C4-dicarboxylate ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 187 to 209 (23 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details amino acids 301 to 323 (23 residues), see Phobius details amino acids 327 to 342 (16 residues), see Phobius details amino acids 346 to 347 (2 residues), see Phobius details amino acids 353 to 377 (25 residues), see Phobius details PF00375: SDF" amino acids 12 to 404 (393 residues), 382 bits, see alignment E=1.7e-118

Best Hits

Swiss-Prot: 82% identical to DCTA_VEREI: C4-dicarboxylate transport protein (dctA) from Verminephrobacter eiseniae (strain EF01-2)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 100% identity to hse:Hsero_2618)

MetaCyc: 71% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IXL2 at UniProt or InterPro

Protein Sequence (441 amino acids)

>HSERO_RS13105 C4-dicarboxylate ABC transporter (Herbaspirillum seropedicae SmR1)
MTAQKPPLYKSLYFQVLVAIVIGILLGHFYPSTGEAMKPLGDGFVKLIKMIIAPVIFCTV
VIGIAGMEDMKKVGKTGGLALLYFEVVSTVALIIGLLLVNFLQPGVGMNVDPASLDTKSI
AAYTAPGKMGSVTDFVLGIIPTSMVDAFAKGDVLQVLLVAVLFGFALHKFGGRGTLVFDF
IEKISHVLFSVVGAIMKVAPIGAFGAMSFTIGKYGVGSLFSLAKLMGTFYLTCLLFIFVV
LGIITRLHGFSIWKFVKYIKEELLIVLGTSSSESVLPRMLAKMENAGAKKTVVGLVIPTG
YSFNLDGTAIYLTMAAVFIAQATNTPMTFVQELTLLGVLLLTSKGAAGITGSGFIVLAAT
LSAVGHVPVAGLALILGIDRFMSEARALTNTIGNGVATLVVAKWSGELDSERLTKVLNNE
TVEDAQAPESILDRTDAKMHH