Protein Info for HSERO_RS12515 in Herbaspirillum seropedicae SmR1

Annotation: glycogen synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 transmembrane" amino acids 508 to 528 (21 residues), see Phobius details PF08323: Glyco_transf_5" amino acids 4 to 239 (236 residues), 204.4 bits, see alignment E=3.4e-64 TIGR02095: glycogen/starch synthase, ADP-glucose type" amino acids 4 to 478 (475 residues), 488.6 bits, see alignment E=9.4e-151 PF13692: Glyco_trans_1_4" amino acids 297 to 441 (145 residues), 42.8 bits, see alignment E=1e-14 PF00534: Glycos_transf_1" amino acids 298 to 452 (155 residues), 68.7 bits, see alignment E=7e-23

Best Hits

Swiss-Prot: 42% identical to GLGA_AROAE: Glycogen synthase (glgA) from Aromatoleum aromaticum (strain EbN1)

KEGG orthology group: K00703, starch synthase [EC: 2.4.1.21] (inferred from 100% identity to hse:Hsero_2504)

Predicted SEED Role

"Glycogen synthase, ADP-glucose transglucosylase (EC 2.4.1.21)" in subsystem Glycogen metabolism (EC 2.4.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.21

Use Curated BLAST to search for 2.4.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IWI3 at UniProt or InterPro

Protein Sequence (529 amino acids)

>HSERO_RS12515 glycogen synthase (Herbaspirillum seropedicae SmR1)
LQARVLLVSSEAVPLVKTGGLADVITALAVSLRKAGIDASILLPAYPEAVRNLGHTEQIG
LKHGLPGGAGRLLRGIIPGTDVPALLLDTARFRQRGANPYLDTDGVEFSDNAVCFADLSH
AAVAICAGETSLSAPHVVHANDWHAGLIPCLLKLRGLDHIGTMLTIHNLAFQGNFALESA
EQIGIPQHLLTGDGVEYWGKLSFLKAGIRFSDCVSTVSRNYAHEIMTPRFGCGMDGILSF
RKLDLRAIPNAIDAELWNPADDPLIARNFSVGNMKGKAACKRDLQKLFGLPVDPFAPVMG
MGSRLSHQKMADVVIEALPGIMERHPRMQMVVLGCGDHDYEKSLLALAQRYAGRIAVHIG
YDERRAHALHAGSDMLLHPTRFEPFGLTPLYAMRYGAIPIGSRVGGLVDTVCDADLDAER
ATGVLFDGDRASDMEAAVDRAFALYADNERWQSMQRNAMSIDCDWAGPTRAYIDAYAHVA
DMAVRPLFAPRPQPVERPAVQHERMVRPAAAIAAALASVVGVPAAVAAA