Protein Info for HSERO_RS12410 in Herbaspirillum seropedicae SmR1

Annotation: multidrug transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 51 to 381 (331 residues), 255.9 bits, see alignment E=2.3e-80 PF16576: HlyD_D23" amino acids 65 to 299 (235 residues), 56 bits, see alignment E=5.4e-19 PF13533: Biotin_lipoyl_2" amino acids 76 to 122 (47 residues), 40.9 bits, see alignment 2.1e-14 PF13437: HlyD_3" amino acids 186 to 293 (108 residues), 32.2 bits, see alignment E=2.3e-11

Best Hits

Swiss-Prot: 41% identical to MDTA_PHOLL: Multidrug resistance protein MdtA (mdtA) from Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)

KEGG orthology group: K07799, putative multidrug efflux transporter MdtA (inferred from 100% identity to hse:Hsero_2482)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IWG1 at UniProt or InterPro

Protein Sequence (403 amino acids)

>HSERO_RS12410 multidrug transporter (Herbaspirillum seropedicae SmR1)
MSTSPTPPRRSRLAIALAAALLMAGIGGWTHLQRASAADQPQAKAPPPVSVTLASVQERD
LPQYLAGVGTVTANASVVVKTRIDGQLEKVGFQEGEDVKKGQLLAQIDARALQAQLAQAE
AQRAKDSATLMNARLDLQRYTTLRSQDAATQQQLDTQKALVAQLEAAVKTDEAQVAYAKV
QLSYTTINAPISGRVGARLVDPGNIVHATDANGLVVINQIDPITLVFTLPEEAVAGINRA
QRAHQQPLQVSAYARDSQEVLATGKLVLLDNQINTTNGTVQLKARFDNPDHKLWPGQYVN
ARLQMRSHGNALTVPAAAIQRNQQGTYVYAIDQEDQARMQPVKVERIQDGIAVLAAGNAV
QAGQRVVIDGQYKLKPGSRIVESKPQPAKAEANAEAKAKGNAK