Protein Info for HSERO_RS12405 in Herbaspirillum seropedicae SmR1

Annotation: RND transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 5 to 468 (464 residues), 432.3 bits, see alignment E=1.2e-133 PF02321: OEP" amino acids 59 to 244 (186 residues), 78.1 bits, see alignment E=3.9e-26 amino acids 284 to 465 (182 residues), 73.3 bits, see alignment E=1.1e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_2481)

Predicted SEED Role

"Heavy metal RND efflux outer membrane protein, CzcC family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IWG0 at UniProt or InterPro

Protein Sequence (476 amino acids)

>HSERO_RS12405 RND transporter (Herbaspirillum seropedicae SmR1)
MTALVLAALLGGCAVGPDYARPALDLPQAYKETGPWKLAAPRQIDDHQPWWEAYGDPVLN
ALMDQANAANQTIQQAAAQYRQAQATAEVARASLWPTIGAQAGASRAQTNTNGVQRLGNS
YSVGLNASWEADLWGRIRRGAEAGEANAQASAASLAAARLSIQATLAQDYLQLRVTDLQK
DLYRRTVAAYTRSLQLSTHQYEAGTALRSDVAQAETQLRAAQAQLIDLDDTRNQLEHAIA
MLIGKAPAQFSLPALPPAAASDSAIDANAARLQGSLPQIPVGLPSELLERRPDIANAERL
AAAANANIGVARAAYFPTLTLSASGGYNSLAFANLFNTPSRVWSLGSALAESLFDGGARS
ARNDAAVAAYDAAVAQYKQTVLGGLQEVEDKLSTLRVLDQESTVQAQAVQSAQLAERLAM
RQYEAGTVTYLSVVTTQAASLTNQRNAVTLLGRQLVASVALIKATGGGWQAGRDAP