Protein Info for HSERO_RS12315 in Herbaspirillum seropedicae SmR1

Annotation: cytochrome O ubiquinol oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 667 transmembrane" amino acids 26 to 46 (21 residues), see Phobius details amino acids 67 to 84 (18 residues), see Phobius details amino acids 113 to 136 (24 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 199 to 223 (25 residues), see Phobius details amino acids 241 to 264 (24 residues), see Phobius details amino acids 285 to 308 (24 residues), see Phobius details amino acids 320 to 342 (23 residues), see Phobius details amino acids 356 to 378 (23 residues), see Phobius details amino acids 390 to 413 (24 residues), see Phobius details amino acids 425 to 449 (25 residues), see Phobius details amino acids 467 to 488 (22 residues), see Phobius details amino acids 502 to 527 (26 residues), see Phobius details amino acids 599 to 617 (19 residues), see Phobius details amino acids 623 to 641 (19 residues), see Phobius details TIGR02843: cytochrome o ubiquinol oxidase, subunit I" amino acids 12 to 656 (645 residues), 1142.8 bits, see alignment E=0 PF00115: COX1" amino acids 66 to 512 (447 residues), 503.5 bits, see alignment E=2.5e-155

Best Hits

Swiss-Prot: 68% identical to CYOB_ECOLI: Cytochrome bo(3) ubiquinol oxidase subunit 1 (cyoB) from Escherichia coli (strain K12)

KEGG orthology group: K02298, cytochrome o ubiquinol oxidase subunit I [EC: 1.10.3.-] (inferred from 100% identity to hse:Hsero_2463)

MetaCyc: 68% identical to cytochrome bo3 subunit 1 (Escherichia coli K-12 substr. MG1655)
RXN-21817 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit I (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IWE2 at UniProt or InterPro

Protein Sequence (667 amino acids)

>HSERO_RS12315 cytochrome O ubiquinol oxidase (Herbaspirillum seropedicae SmR1)
MSDNFDLIKLIFGRLSLEAIPYHEPILIGTFAMVALGGIVVLGLLTKYRLWGMLWRDWFT
SIDHKRIGIMYIVLAIVMLLRGFADAVMMRAQQAIAFGDNAGFLPPHHYDQVFTAHGVIM
IFFVAMPLVTGLMNYVVPLQIGARDVAFPFLNNFSFWMTTFGALLVMASLFVGEFARTGW
LAYPPLSGILYSPDVGVDYYIWALQVAGVGTLLSGINLVVTIVKMRAPGMNMMKMPVFTW
TSLCTNVLIVAAFPVLTAVLAMLSLDRVFGTNFFTNDMGGNAMMYVNLIWIWGHPEVYIL
VLPAFGIFSEIVSTFSGKRLFGYTSMVYATVVITILSYLVWLHHFFTMGSGASVNSFFGI
TTMIISIPTGAKIFNWLFTMYRGRIRFEVPMLWTIGFMVTFVIGGMTGVLLAVPPADFVL
HNSLFLIAHFHNVIIGGVVFGMFAGINFWFPKAFGFKLNEFWGKCSFWFWLVGFYLAFMP
LYVLGLMGVTRRMSHFDDPSLQIWFVVAAIGAGLIALGIGSFIIQIAVSIRDRKKLADVT
GDPWNGRTLEWSTSSPPPAYNFAFTPVVHDNDAWADMKKNKYQRPLGDFVEIHMPKNTGA
GFIIAALSAVLGFTLIWHMWLPAVATFVVLVAATIIHTFNYNRDYYIPADEVVRVEAERT
RLLNSHV