Protein Info for HSERO_RS12235 in Herbaspirillum seropedicae SmR1

Annotation: biotin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 TIGR00433: biotin synthase" amino acids 44 to 341 (298 residues), 396.8 bits, see alignment E=3.1e-123 PF04055: Radical_SAM" amino acids 77 to 232 (156 residues), 80.6 bits, see alignment E=1.6e-26 PF06968: BATS" amino acids 250 to 341 (92 residues), 102.3 bits, see alignment E=1.4e-33

Best Hits

Swiss-Prot: 70% identical to BIOB2_POLSJ: Biotin synthase 2 (bioB2) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K01012, biotin synthetase [EC: 2.8.1.6] (inferred from 100% identity to hse:Hsero_2447)

MetaCyc: 61% identical to biotin synthase (Escherichia coli K-12 substr. MG1655)
Biotin synthase. [EC: 2.8.1.6]

Predicted SEED Role

"Biotin synthase (EC 2.8.1.6)" in subsystem Biotin biosynthesis (EC 2.8.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IWC6 at UniProt or InterPro

Protein Sequence (347 amino acids)

>HSERO_RS12235 biotin synthase (Herbaspirillum seropedicae SmR1)
MSHCPSAPAGQTSAPLHFHRPANAANAAHSTRADDARRDAVAALFELPFLDLLYQAQTVH
RQHHPANQVQLSSLLSIKTGGCAEDCGYCAQSAHHKEAGVPAGKLMAVDEVVQAARAARD
QGATRFCMGAAWRNPKERDMPALTEMVSQVRALGLETCMTLGMLEQAQAEALKEAGLDYY
NHNLDTAPDFYGQVISTRSYQDRLDTLERVHLAGLSVCCGGIIGMGESRAQRAGLIAQLA
ALPVPPQSVPINHLVPIAGTPLQDVPALDEFEFVRTVAVARIALPHAVIRLSAGRESMSD
ATQALCFAAGANSIFLGSKLLTTPNAPVSSDLDLLARLGLQATAASA