Protein Info for HSERO_RS12140 in Herbaspirillum seropedicae SmR1

Annotation: 5-deoxyglucuronate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04962: KduI
  • amino acids 4 to 261 (258 residues), 371.2 bits, E=1.3e-115
• TIGR04378: 5-deoxy-glucuronate isomerase
  • amino acids 16 to 261 (246 residues), 348.6 bits, E=1e-108

Best Hits

Swiss-Prot: 56% identical to IOLB_GEOKA: 5-deoxy-glucuronate isomerase (iolB) from Geobacillus kaustophilus (strain HTA426)

KEGG orthology group: K03337, 5-deoxy-glucuronate isomerase [EC: 5.3.1.-] (inferred from 100% identity to hse:Hsero_2430)

Predicted SEED Role

"5-deoxy-glucuronate isomerase (EC 5.3.1.-)" in subsystem Inositol catabolism (EC 5.3.1.-)

MetaCyc Pathways

• myo-inositol degradation I (7/7 steps found)
• myo-, chiro- and scyllo-inositol degradation (7/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of ansamycins
• Galactose metabolism
• Inositol phosphate metabolism
• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.-

Use Curated BLAST to search for 5.3.1.-

Sequence Analysis Tools

See D8IVJ0 at UniProt or InterPro

Protein Sequence (264 amino acids)

>HSERO_RS12140 5-deoxyglucuronate isomerase (Herbaspirillum seropedicae SmR1)
MSLLVKAQRSGRDIVQVTPQSAGWRYVGFSAHRLARGEQLALDTGDREYCVVILAGVVSV
QAGSSQWREIGQRRSVFDDVPAASVYVPHHHRLTLTADSDAEVALCSAPGFGELPPRLIG
PEAVTQSVRGEGSNTRYVSDILPQTAAADHLLVVEVRTPGGHSSSYPPHKHDTDNLPQES
FLEETYYHRLNPAQGFAFQRVYVDDRSLDESMAVENHDVVMVPRGYHPVVVPHGYESYYL
NVMAGPTRSWHFRNDPAHEWMLKR