Protein Info for HSERO_RS12085 in Herbaspirillum seropedicae SmR1

Annotation: RNA polymerase sigma-E factor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 27 to 181 (155 residues), 86.2 bits, see alignment E=9.4e-29 PF04542: Sigma70_r2" amino acids 31 to 93 (63 residues), 32.1 bits, see alignment E=1.6e-11 PF08281: Sigma70_r4_2" amino acids 130 to 178 (49 residues), 55 bits, see alignment E=1e-18 PF04545: Sigma70_r4" amino acids 131 to 179 (49 residues), 49.8 bits, see alignment E=3.8e-17 PF07638: Sigma70_ECF" amino acids 132 to 180 (49 residues), 29.8 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to hse:Hsero_2419)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IVH9 at UniProt or InterPro

Protein Sequence (186 amino acids)

>HSERO_RS12085 RNA polymerase sigma-E factor protein (Herbaspirillum seropedicae SmR1)
MHGPSANSIEQEDIDLIERIAQGDRGAFERLYRSYFPRLAQFLRRLVWDGPLSEEIINDT
MFVVWTKAQTYNGQSKVSTWIFAIAYKQGLKALSRVDTPVEMDMETMVSDELVEPEHQLS
ETQLRRHIGGALERLSFEHRTVMTLTYFHGMSYEEIADTMGCSINTVKTRMFYARQKLKV
FLSAYA