Protein Info for HSERO_RS11660 in Herbaspirillum seropedicae SmR1

Annotation: taurine ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 42 to 62 (21 residues), see Phobius details amino acids 103 to 126 (24 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 210 to 210 (1 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 254 to 279 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 117 to 286 (170 residues), 99.2 bits, see alignment E=1.3e-32

Best Hits

Swiss-Prot: 57% identical to TAUC_ECOLI: Taurine transport system permease protein TauC (tauC) from Escherichia coli (strain K12)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to hse:Hsero_2329)

MetaCyc: 57% identical to taurine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IV89 at UniProt or InterPro

Protein Sequence (293 amino acids)

>HSERO_RS11660 taurine ABC transporter permease (Herbaspirillum seropedicae SmR1)
MNDQVQPLPLLNALRPDPSAQAQADQPPPLVKMRSFGIAEGSTARISIAAGIVILALWWL
IAQTGWVPHLFLPTPAEVLKVAQSIWEDGYANATLAEHVGASLLRILTAGVIAVLLGIPV
GLLMGLNRWVKGVLDTPIEFYWPLPPLAYLPLMIIWLGIGEASKITLLTLAMFAPVVLSA
QAGVRSLPQERVNAALSLGATRWQLLTEVVLPSALPEILTGIRIALGVGWSTLVAAELIA
SNRGIGYMIMSASHFLATDAVFVGIALIATCAFAFSYGMRLLERALVPWKGKS