Protein Info for HSERO_RS11560 in Herbaspirillum seropedicae SmR1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 46 (17 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details amino acids 206 to 231 (26 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details PF09678: Caa3_CtaG" amino acids 41 to 276 (236 residues), 214.3 bits, see alignment E=8.8e-68

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_2309)

Predicted SEED Role

"FIG00987188: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IV69 at UniProt or InterPro

Protein Sequence (276 amino acids)

>HSERO_RS11560 hypothetical protein (Herbaspirillum seropedicae SmR1)
LLLVACPLPGAAHTLGIAAADTTRWNDEPWLIGTVLLSLLLYLRGHGRLRARRVASSAQL
ACFGSGWLCLAAALLSPIDTAGAASFAAHMVQHELLMIAAAPLLIAGRPVKAWLWALPAG
WRKPVGRWFGRRAWLSWIRQLSRPLPAWLIHFAAVWGWHVPACFEAALRHEALHMTQHLS
FFVSALLFWWSVLASWRRTQPDHGALLYLFSTMMHTSALGALLALSSRLWYPAYGELPWS
YGISPLEDQQLGGLIMWIPGALSYVIVALVLCARWL