Protein Info for HSERO_RS11045 in Herbaspirillum seropedicae SmR1

Annotation: zinc-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 PF00383: dCMP_cyt_deam_1" amino acids 18 to 115 (98 residues), 99.5 bits, see alignment E=9e-33 PF14437: MafB19-deam" amino acids 21 to 163 (143 residues), 138.3 bits, see alignment E=1.7e-44

Best Hits

Swiss-Prot: 56% identical to TADA_ECOLI: tRNA-specific adenosine deaminase (tadA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_2212)

MetaCyc: 56% identical to tRNA adenosine34 deaminase (Escherichia coli K-12 substr. MG1655)
3.5.4.-

Predicted SEED Role

"tRNA-specific adenosine-34 deaminase (EC 3.5.4.-)" in subsystem tRNA processing (EC 3.5.4.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.-

Use Curated BLAST to search for 3.5.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IU49 at UniProt or InterPro

Protein Sequence (185 amino acids)

>HSERO_RS11045 zinc-binding protein (Herbaspirillum seropedicae SmR1)
MDAPCTVPSASSAAGEADLLHMRAALEQARHAWALGEVPVGAVVVKDGVVIATGFNQPIG
KHDPTAHAEIMALRRAAEILGNYRLPGCELYVTLEPCVMCSGAMMHARLARVVFGAADPK
TGACGSVLNLFEQDQLNHHTALLGGVMAEECGQLLKDFFAMRREQLKQQRLQAAAGEGSQ
ENGAA