Protein Info for HSERO_RS11035 in Herbaspirillum seropedicae SmR1

Annotation: 7-cyano-7-deazaguanine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 TIGR04508: 7-carboxy-7-deazaguanine synthase" amino acids 3 to 211 (209 residues), 348.5 bits, see alignment E=6.9e-109 PF04055: Radical_SAM" amino acids 46 to 131 (86 residues), 37 bits, see alignment E=2e-13

Best Hits

Swiss-Prot: 65% identical to QUEE_BURM1: 7-carboxy-7-deazaguanine synthase (queE) from Burkholderia multivorans (strain ATCC 17616 / 249)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_2210)

Predicted SEED Role

"Queuosine Biosynthesis QueE Radical SAM" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IU47 at UniProt or InterPro

Protein Sequence (211 amino acids)

>HSERO_RS11035 7-cyano-7-deazaguanine reductase (Herbaspirillum seropedicae SmR1)
VTYSIKEIFYTLQGEGAHAGRPAVFCRFSGCNLWTGREEDRVRAICQFCDTDFVGTDGEN
GGKFKSPAELAAKIDSLWPARYAPSKYVVFTGGEPLLQLDAALIEAMHAVGFEIAIETNG
TIDVPDGVDWICVSPKMGSELKVRRGSELKVVVPQPGQPLDEYEKLDFQHFLLQPMDGLQ
AAANTRLAIEMVKNNPKWKLSIQTHKLLNIP