Protein Info for HSERO_RS11020 in Herbaspirillum seropedicae SmR1

Annotation: GMP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 9 to 203 (195 residues), 246.4 bits, E=1.4e-77
• PF00117: GATase
  • amino acids 10 to 199 (190 residues), 149.1 bits, E=3.1e-47
• PF07722: Peptidase_C26
  • amino acids 73 to 182 (110 residues), 38.8 bits, E=2.2e-13
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 212 to 530 (319 residues), 482.4 bits, E=6.2e-149
• PF02540: NAD_synthase
  • amino acids 217 to 290 (74 residues), 33.7 bits, E=5.5e-12
• PF03054: tRNA_Me_trans
  • amino acids 228 to 260 (33 residues), 20.9 bits, see alignment (E = 6.4e-08)
• PF00958: GMP_synt_C
  • amino acids 443 to 529 (87 residues), 142.4 bits, E=9.6e-46

Best Hits

Swiss-Prot: 83% identical to GUAA_PARP8: GMP synthase [glutamine-hydrolyzing] (guaA) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 100% identity to hse:Hsero_2206)

MetaCyc: 66% identical to GMP synthetase (Escherichia coli K-12 substr. MG1655)
GMP synthase (glutamine-hydrolyzing). [EC: 6.3.5.2]; 6.3.5.2 [EC: 6.3.5.2]

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• superpathway of purine nucleotide salvage (11/14 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

See D8IU43 at UniProt or InterPro

Protein Sequence (530 amino acids)

>HSERO_RS11020 GMP synthase (Herbaspirillum seropedicae SmR1)
MSTHSHSKILILDFGSQVTQLIARRVREAGVFSEVFPHDVTDEFVRNYGAAGVILSGGPN
SVTEGDTPRAPQAVFELGVPVLGICYGMQTMAEQLGGKVDNGHLREFGYAEVRAHGHTKL
LDNISDFTNAQGHGMLKVWMSHGDKVNEMPAGFKLMASTGNCPIAGMADEERRFYGVQFH
PEVTHTVQGKAMLGRFVHEICGCQSDWNMPDYIAEAVEMIRQQVGSDEVILGLSGGVDSS
VAAALIHRAIGDQLTCVFVDHGLLRLDEGKMVMEMFAKNLGVKVIHVDATAQFMGHLAGV
TDPEAKRKIIGREFVEVFQAESAKLTSAKWLAQGTIYPDVIESAGKGKKTAHTIKSHHNV
GGLPETLNLKLLEPLRELFKDEVRELGVALGLPPEMVYRHPFPGPGLGVRILGEVKKEYA
DLLRRADAIFIEELRNTKDEDGQTWYEKTSQAFAVFLPVKSVGVMGDGRTYEYVVALRAV
QTQDFMTAHWAHLPHELLGRVSNRIINEVRGLNRVVYDISGKPPATIEWE