Protein Info for HSERO_RS11015 in Herbaspirillum seropedicae SmR1

Annotation: inosine 5'-monophosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 PF00478: IMPDH" amino acids 7 to 475 (469 residues), 558.4 bits, see alignment E=1.7e-171 TIGR01302: inosine-5'-monophosphate dehydrogenase" amino acids 7 to 457 (451 residues), 637.3 bits, see alignment E=7.1e-196 PF00571: CBS" amino acids 93 to 138 (46 residues), 39.8 bits, see alignment 1.4e-13 amino acids 154 to 202 (49 residues), 25.2 bits, see alignment 5.2e-09 PF03060: NMO" amino acids 218 to 376 (159 residues), 45.6 bits, see alignment E=2e-15 PF01070: FMN_dh" amino acids 261 to 366 (106 residues), 35.9 bits, see alignment E=1.4e-12

Best Hits

Swiss-Prot: 63% identical to IMDH_HAEIN: Inosine-5'-monophosphate dehydrogenase (guaB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 100% identity to hse:Hsero_2205)

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.205

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IU42 at UniProt or InterPro

Protein Sequence (489 amino acids)

>HSERO_RS11015 inosine 5'-monophosphate dehydrogenase (Herbaspirillum seropedicae SmR1)
MRLLQKALTFDDVLLVPAFSDILPKDTSLTTRLTRNISLNIPLVSAAMDTVTEARLAIAM
AQEGGIGIIHKNLTPKEQAREVSKVKRFESGVVRDPITIPPTMKIRDVIALSKQHGISGF
PVVEGKALVGIITNRDLRFEEELDAEVRAKMTPREKLVYVKENGSSADPEEAKRLMNKHR
LERVMVVNDAFELRGLITVKDIEKSTEHPFACKDVHGKLRVGAAVGVGPDNDERIELLVA
AGVDVIVVDTAHGHSAGVLNRVKWVKTKYPHVEVIGGNIATAAAAKALVEHGADAVKVGI
GPGSICTTRIVAGVGVPQISAIANVAEALKGTGVPVIADGGIRFSGDVAKALAAGASAVM
MGSMFAGTEEAPGEVILYQGRSYKSYRGMGSLGAMADGSADRYFQDGDNTADKFVPEGIE
GRVAYKGSVVAILYQLVGGVRSSMGYCGCASIDDFRERAEFVEITAAGMRESHVHDVQIT
KEAPNYRAD