Protein Info for HSERO_RS10995 in Herbaspirillum seropedicae SmR1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 PF13181: TPR_8" amino acids 47 to 79 (33 residues), 12.9 bits, see alignment (E = 4.7e-05) amino acids 181 to 209 (29 residues), 21.1 bits, see alignment (E = 1.2e-07) PF13432: TPR_16" amino acids 182 to 229 (48 residues), 24 bits, see alignment 2e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_2201)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IU38 at UniProt or InterPro

Protein Sequence (528 amino acids)

>HSERO_RS10995 hypothetical protein (Herbaspirillum seropedicae SmR1)
MNSPDPATLARLMGLMCDAIALRGAQQAEAALAALDQALALDPSFLPLYMQRADLLQEMG
ALPEAIAACAACLDLAPDYDEARALHRSLLQRWATQCELQTADEGASGSAALIDLARARL
QLDQPLPALAAVERALASGQAGLALHALHADILLRLNRHEEALECYPPAADEDQARALHA
FNMADILRRMGRIEQAQAAFEQALRWHPDFPEAEVGRAHMLLSQQHYAEGWRAHEARFGI
AELARRGIDSPRPRWRAGEPVRGKRVLLWAEQGQGDTLQFARYIPLVAQQAAEVSLCAPA
SLLAVLAPCLPQVRCMANPGEAPDHDLHASLLSLPLLLGLPDPRQGPPSPYLAAQPQRVQ
QWQAYLSALWPAMPRRPRLGIAWAGRQYATVHHSRDIPLDALAPLWTLPADFVSLQVEVP
AGDQAAHATLAQRLHTPTLVDWADTAALLCALDLVISVDTAVVHLAGALGVPCLLPLRYD
GEWRWGVKGSQTPWYPSLQLLRQRERGQWGPVVEEMLAVCTQRLLQPK