Protein Info for HSERO_RS10830 in Herbaspirillum seropedicae SmR1

Annotation: UTP--glucose-1-phosphate uridylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01099: UTP--glucose-1-phosphate uridylyltransferase" amino acids 5 to 269 (265 residues), 374.6 bits, see alignment E=1.5e-116 PF00483: NTP_transferase" amino acids 12 to 270 (259 residues), 102 bits, see alignment E=2.1e-33

Best Hits

Swiss-Prot: 52% identical to YNGB_BACSU: Probable UTP--glucose-1-phosphate uridylyltransferase YngB (yngB) from Bacillus subtilis (strain 168)

KEGG orthology group: K00963, UTP--glucose-1-phosphate uridylyltransferase [EC: 2.7.7.9] (inferred from 100% identity to hse:Hsero_2168)

MetaCyc: 50% identical to UTP--glucose-1-phosphate uridylyltransferase (Staphylococcus aureus)
UTP-monosaccharide-1-phosphate uridylyltransferase. [EC: 2.7.7.64, 2.7.7.9]

Predicted SEED Role

"UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9)" (EC 2.7.7.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.9

Use Curated BLAST to search for 2.7.7.64 or 2.7.7.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IU05 at UniProt or InterPro

Protein Sequence (296 amino acids)

>HSERO_RS10830 UTP--glucose-1-phosphate uridylyltransferase (Herbaspirillum seropedicae SmR1)
MIKKIKKAVFPVAGLGSRFLPATKAQPKEMLPIVDKPLIHYAVEEAVAAGITEMVFITGR
NKRAIEDHFDKAYELESELEAAGKKKLLEIVQNVVPKSVNCIFIRQSVPLGLGHAVLCAR
PVVGEEPFAVLLADDFMDTDAGVKPVLAQMTEIYEREGMSMLAVQEVPQSDTKQYGIVSA
TPYQPNLERVNAIVEKPAPEEAPSTLAVVGRYVLNNRIFDYLENIGRGAGGEIQLTDGIA
KLMQAESVLAYRYQGQRYDCGSKLGYLKATVAMGMKHPETGAAFSEFLKDVAGKQA