Protein Info for HSERO_RS10770 in Herbaspirillum seropedicae SmR1

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 56 to 79 (24 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 121 to 138 (18 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 14 to 110 (97 residues), 107.8 bits, see alignment E=1.7e-35 PF00528: BPD_transp_1" amino acids 34 to 215 (182 residues), 68.5 bits, see alignment E=3.3e-23

Best Hits

Swiss-Prot: 44% identical to YECS_ECOL6: L-cystine transport system permease protein YecS (yecS) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to hse:Hsero_2156)

MetaCyc: 44% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IT96 at UniProt or InterPro

Protein Sequence (221 amino acids)

>HSERO_RS10770 amino acid ABC transporter permease (Herbaspirillum seropedicae SmR1)
MLMEILELLQQAAPTLAKGVGYTLLFALASMLGGLVLGFVLAVARIVPWRPIHWPAAIYV
SMMRGTPLLVQIFVVYYGLPGMGIEFSPLTAGVLTLSLNASAYLSESLRGAILGVTRGQW
NAAFSVGLTYFQTLRYIIVPQAVRIAVPSMSNTLISLIKDTSLVSVITVTELMLATKEVI
AVTFRPLPLYVAAAAIYWMLSLCFEALQHRLEKKLGKAHQI