Protein Info for HSERO_RS10580 in Herbaspirillum seropedicae SmR1

Annotation: molybdate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF12849: PBP_like_2" amino acids 24 to 195 (172 residues), 28.2 bits, see alignment E=5e-10 PF13531: SBP_bac_11" amino acids 31 to 253 (223 residues), 212.3 bits, see alignment E=2.5e-66 TIGR01256: molybdate ABC transporter, periplasmic molybdate-binding protein" amino acids 36 to 252 (217 residues), 198.3 bits, see alignment E=7.7e-63 PF01547: SBP_bac_1" amino acids 36 to 246 (211 residues), 73.7 bits, see alignment E=8e-24 PF12974: Phosphonate-bd" amino acids 37 to 253 (217 residues), 34.2 bits, see alignment E=6e-12 PF04069: OpuAC" amino acids 45 to 205 (161 residues), 22.8 bits, see alignment E=2e-08 PF13343: SBP_bac_6" amino acids 85 to 253 (169 residues), 40.3 bits, see alignment E=7.9e-14

Best Hits

KEGG orthology group: K02020, molybdate transport system substrate-binding protein (inferred from 100% identity to hse:Hsero_2117)

Predicted SEED Role

"Molybdenum ABC transporter, periplasmic molybdenum-binding protein ModA (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IT58 at UniProt or InterPro

Protein Sequence (256 amino acids)

>HSERO_RS10580 molybdate ABC transporter substrate-binding protein (Herbaspirillum seropedicae SmR1)
MSTRSRLNTALGAACAATLMLAAGAAQAADLVVSAAASLTNAFKELAQSFEQQHPGVKVV
SNFGASDILMRQIVRGAPADVFASADQTAMDKAVAEKAVDPATRKNFAANQIVLIVTQGS
RLAPTSLADLTQPDYKRIALGNPASVPFGRYTRTALEQAGLWSQVQAKGVMAENVRTSLD
YVARGEADAGFVFATDAAIMPEKVKVALRLPSDQPATYPIAVTAGSRQPALAAQFVAYVL
SPTGQAVLARYGFLKP