Protein Info for HSERO_RS10575 in Herbaspirillum seropedicae SmR1

Annotation: molybdate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 144 to 166 (23 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details TIGR02141: molybdate ABC transporter, permease protein" amino acids 9 to 210 (202 residues), 245.7 bits, see alignment E=1.8e-77 PF00528: BPD_transp_1" amino acids 23 to 213 (191 residues), 73.4 bits, see alignment E=9.9e-25

Best Hits

Swiss-Prot: 41% identical to MODB_HAEIN: Molybdenum transport system permease protein ModB (modB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02018, molybdate transport system permease protein (inferred from 100% identity to hse:Hsero_2116)

Predicted SEED Role

"Molybdenum transport system permease protein ModB (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IT57 at UniProt or InterPro

Protein Sequence (224 amino acids)

>HSERO_RS10575 molybdate ABC transporter permease (Herbaspirillum seropedicae SmR1)
MHPVWTPLLLSLKVAGLATLLNLVLGVAAAYGLSRWRSALRDFIDSVLTLPLVLPPTVLG
YYLLVLFGRRGALGAWLERMGIELVFTWQGAVLASTVVAFPLVLKSARAAFESVDHQMED
AARVLGVSEAGVFFRVSLPLAMRGIMAGVLLAFARALGEFGATLMVAGNLPGRTQTLSVA
IYEAVQAGDDGSATLLVVITSITCIVLLMVAGRLTPDRAQQQLR