Protein Info for HSERO_RS10500 in Herbaspirillum seropedicae SmR1

Annotation: manganese transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 transmembrane" amino acids 74 to 99 (26 residues), see Phobius details amino acids 120 to 144 (25 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 223 to 241 (19 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 312 to 330 (19 residues), see Phobius details amino acids 360 to 379 (20 residues), see Phobius details amino acids 385 to 405 (21 residues), see Phobius details amino acids 425 to 445 (21 residues), see Phobius details TIGR01197: metal ion transporter, metal ion (Mn2+/Fe2+) transporter (Nramp) family" amino acids 41 to 414 (374 residues), 377.1 bits, see alignment E=6.4e-117 PF01566: Nramp" amino acids 62 to 420 (359 residues), 451.8 bits, see alignment E=8.5e-140

Best Hits

Swiss-Prot: 65% identical to MNTH_RALSO: Divalent metal cation transporter MntH (mntH) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03322, manganese transport protein (inferred from 100% identity to hse:Hsero_2102)

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IT43 at UniProt or InterPro

Protein Sequence (448 amino acids)

>HSERO_RS10500 manganese transporter (Herbaspirillum seropedicae SmR1)
LPFTFRFPRIPGLPTTATAPFCPSEVAGTVQVPRGASVWQKLRIYVGPGLLVSIGYMDPG
NWATSIQAGAQFGYQLLFVVMLSSLAAIVLQCLCARLGIATGKDLAVHSREHYPPAVGKG
MWVLAELSIIACDLAEVLGCALAFNLLLGVSLPVGVLLTALDTLIVLGLKGRGFRQVEAI
ILGLVITIAACLLAQLAFVKADWHEVMQGFVPSLQAISSREPLYLAIGIIGATVMPHNLY
LHSSIVQTRSVQRDPASLLEAVRYTRVDTTVSLLIAMVINATILILAAAAFHKSGNTQVA
ELDEAYHLLDPITGSAMAAILFGVGLFASGQSSTFTGTIAGQVIMEGFLKLKIPCWQRRV
ITRALALVPALIGVLTLGPHSVGKLLVASQVVLSLQLPFAMYPLIRLTSRRDLMGDLVNR
WWVSGLAWVLFAAISAANVWLVWQVFAD