Protein Info for HSERO_RS10490 in Herbaspirillum seropedicae SmR1

Annotation: gluconate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 16 to 57 (42 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 110 to 141 (32 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details amino acids 274 to 296 (23 residues), see Phobius details amino acids 311 to 328 (18 residues), see Phobius details amino acids 345 to 363 (19 residues), see Phobius details amino acids 370 to 390 (21 residues), see Phobius details amino acids 396 to 418 (23 residues), see Phobius details amino acids 430 to 454 (25 residues), see Phobius details TIGR00791: transporter, gluconate:H+ symporter (GntP) family" amino acids 16 to 451 (436 residues), 426.6 bits, see alignment E=6.3e-132 PF02447: GntP_permease" amino acids 17 to 451 (435 residues), 451.1 bits, see alignment E=4e-139 PF03600: CitMHS" amino acids 17 to 401 (385 residues), 44.9 bits, see alignment E=8.8e-16

Best Hits

KEGG orthology group: K03299, gluconate:H+ symporter, GntP family (inferred from 100% identity to hse:Hsero_2100)

Predicted SEED Role

"Gluconate transporter family protein" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IT41 at UniProt or InterPro

Protein Sequence (456 amino acids)

>HSERO_RS10490 gluconate transporter (Herbaspirillum seropedicae SmR1)
LISTHLAAWAAQDTQLLLVTLTALVTIVVLISFLSIAPFLSILIGTFVAGIGAGLPLEDI
AKAFSKGAGSLLGEAGIIIALGAMLGALMAESGAADRIVNTLLRYARGSFIPWMMALVAL
VVGLPLFFEVGLVMMAPIIFVMARRSELPIMRVAIPALAGMTTLHALLPPHPGPLIAVSA
LHADLGTTMLLGFIVAIPAVIIAGPLYGNFIAPRLNLAEPDQIGKLFSAREGQSQPSFLV
ALVTILLPVVLMLGRTVARIWVTPKTELFEMLNFFGEPIIALTVTVLFAVVVLGWGQGSS
RFEVGATLRRALPPIAGLLLTIGAGGGLKQTLLSAGISDTITKIADGTHMPLILLAWIIA
VALRQATGSATVATTATAGIVAPLVAGLSATHNSLMALAIGAGSVFFCHVNDAGFWMVKE
YFGLNLKQTLATWSVIQTLVSVIGLGMTLVLWGLLV