Protein Info for HSERO_RS10475 in Herbaspirillum seropedicae SmR1

Annotation: molybdenum cofactor biosynthesis protein MoaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 313 to 333 (21 residues), see Phobius details PF03453: MoeA_N" amino acids 23 to 182 (160 residues), 162.3 bits, see alignment E=1.1e-51 TIGR00177: molybdenum cofactor synthesis domain" amino acids 192 to 334 (143 residues), 93.3 bits, see alignment E=6.8e-31 PF00994: MoCF_biosynth" amino acids 195 to 337 (143 residues), 112.7 bits, see alignment E=1.9e-36 PF03454: MoeA_C" amino acids 354 to 420 (67 residues), 43.8 bits, see alignment E=3.8e-15

Best Hits

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 100% identity to hse:Hsero_2097)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IT38 at UniProt or InterPro

Protein Sequence (425 amino acids)

>HSERO_RS10475 molybdenum cofactor biosynthesis protein MoaA (Herbaspirillum seropedicae SmR1)
MSSTPNSSTPPSSAKPARAPMQSVSQALETLLSAAVPVAQREIIDTLDACERVLAEPVTA
SIDVPGMDNSQMDGYAVRAADCASGQARLRVSQRIPAGHVGQPLEPGTAARIFTGAMMPA
GADAVVMQEACEADGEHVVIRHVPAAGEWVRTIGEDIRQGSTILAAGTRLRPQELGLAAS
IGQAQLQVLRRVRVAVFFTGDELTMPGQPLKPGGIYNSNRFLLRGLLQKLGCQVSDFGIV
PDSLQATRETLREAAREHDLIITSGGVSVGEEDHVKPAVEAEGRINMWQIAMKPGKPLAF
GQVRRGEGTGEAFFMGLPGNPVSSFVTFLLFVRPFLLRLQGLPREAVLPQAVALRADFDW
PRADRRQEFLRVRRNAQGGLDLFPSQGSAVLTSTAWADGLIDNPPGQTIAAGDMVQFLAF
DHLLN