Protein Info for HSERO_RS10435 in Herbaspirillum seropedicae SmR1

Annotation: aminotransferase DegT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01041: DegT_DnrJ_EryC1
  • amino acids 12 to 368 (357 residues), 364.8 bits, E=5.6e-113
• PF00266: Aminotran_5
  • amino acids 57 to 243 (187 residues), 23.9 bits, E=2.1e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_2088)

Predicted SEED Role

"UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase (EC 2.6.1.-)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) (EC 2.6.1.-)

KEGG Metabolic Maps

• Aminophosphonate metabolism
• Arginine and proline metabolism
• Caprolactam degradation
• Lysine biosynthesis
• Lysine degradation
• Methionine metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.-

Use Curated BLAST to search for 2.6.1.-

Sequence Analysis Tools

See D8IT29 at UniProt or InterPro

Protein Sequence (373 amino acids)

>HSERO_RS10435 aminotransferase DegT (Herbaspirillum seropedicae SmR1)
MSLPFLPFAKPTIDEPTIAAVGEVLRSGWITSGPKVQAFEKALSDYLGGRIVRTFNSGTC
TMEIALRIAGVGPGDEVITTPISWVATANVILETGATPVFADIDPITRNIDLDKLEAAIT
PRTKAVIPVYLSGLPVDMDRLYAIAAKHKLRVVEDAAQALGSTWNGKRIGAFGDFVSFSL
QANKNITSSEGGFLVLNNAEEARLAEKYRLQGVTRSGFDGLEVDVLGGKFNMTDVAAAIG
LGQFAHIDAITAHRKELARHYFACFGSDFESRYGAQLPVADFENSNWHMFQLVLPERITR
AAFMEKMMEKQIGIGYHYPAIHLLKLYRERGFGEGMFPVAERVGQRIVSLPMFNTMSKDD
VVRSVETVKSVLG