Protein Info for HSERO_RS10295 in Herbaspirillum seropedicae SmR1

Annotation: ATP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 TIGR01026: ATPase, FliI/YscN family" amino acids 25 to 467 (443 residues), 594.2 bits, see alignment E=1.4e-182 TIGR03496: flagellar protein export ATPase FliI" amino acids 33 to 465 (433 residues), 667.3 bits, see alignment E=8e-205 PF02874: ATP-synt_ab_N" amino acids 35 to 97 (63 residues), 21.1 bits, see alignment E=5.6e-08 PF00006: ATP-synt_ab" amino acids 176 to 387 (212 residues), 304.6 bits, see alignment E=5.8e-95 PF18269: T3SS_ATPase_C" amino acids 394 to 464 (71 residues), 91 bits, see alignment E=5.1e-30

Best Hits

KEGG orthology group: K02412, flagellum-specific ATP synthase [EC: 3.6.3.14] (inferred from 100% identity to hse:Hsero_2056)

Predicted SEED Role

"Flagellum-specific ATP synthase FliI" in subsystem Flagellar motility or Flagellum

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ISZ7 at UniProt or InterPro

Protein Sequence (468 amino acids)

>HSERO_RS10295 ATP synthase (Herbaspirillum seropedicae SmR1)
MNSPMPSHSSLWQAYLHNCRSLVAMAEPTMTAGRITRVAGLVMEAVGLKLPVGSPCNVPL
PNGTMIEAEVVGFQDDRLFLMPQSDVEGIVPGTRVYPVEPVRPPPRTGPISFTPRRADEH
SRRLPVGEELLGRVLDGAGRPLDNLGPLHTERSAPLAVRAANPLGRAPIRDILDTGIRAI
NSMLTVGRGQRMGLFAGSGVGKSVLLGMMARYTSADVIVVGLIGERGREVKEFIEQILGA
EGLARSVVVAAPADTPPLMRLQGAAYCTSIAEYFRDQGKDVLLIMDSLTRYAMAQREIAL
AIGEPPATKGYPPSVFAKLPALVERAGNGDEGGGSITAFYTVLTEGDDQQDPIADAARAI
LDGHIVLNRQLAEAGHYPAIDIEQSISRAMHSITDAEHQRSSRHLKQLYSRFQRNRDLIS
VGAYAAGSDPILDEAIALLPRMEAFLQQGIHEQADVSESLRQLTALFG