Protein Info for HSERO_RS10260 in Herbaspirillum seropedicae SmR1

Annotation: flagellar biosynthesis protein FliP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 46 to 74 (29 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details TIGR01103: flagellar biosynthetic protein FliP" amino acids 47 to 243 (197 residues), 306.8 bits, see alignment E=3.3e-96 PF00813: FliP" amino acids 47 to 239 (193 residues), 280 bits, see alignment E=5.7e-88

Best Hits

Swiss-Prot: 68% identical to FLIP_ECOLI: Flagellar biosynthetic protein FliP (fliP) from Escherichia coli (strain K12)

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 100% identity to hse:Hsero_2049)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ISZ0 at UniProt or InterPro

Protein Sequence (244 amino acids)

>HSERO_RS10260 flagellar biosynthesis protein FliP (Herbaspirillum seropedicae SmR1)
LRNRYCWLALLCLPLAASAQQGIPALNSMPAPGGGTNYSLPIQTMLLLTSLSFLPAALLM
MTCFTRIVIVLSLLRQALGTQSTPPTQVLVGLSLFLTFFVMSPVFDRIYTDAYQPFAENK
IQMMEALDKGAQPLKEFMLKQTRESDLALYVKLSRGPALQGPEDVPLRLLVPAFVTSELK
TAFQIGFAIFLPFLIIDMVVASILMSMGMMMMSPALVSLPFKLMLFVLVDGWQLLIGSLA
QSFY