Protein Info for HSERO_RS10240 in Herbaspirillum seropedicae SmR1

Annotation: macrolide ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 657 transmembrane" amino acids 281 to 302 (22 residues), see Phobius details amino acids 530 to 556 (27 residues), see Phobius details amino acids 581 to 608 (28 residues), see Phobius details amino acids 617 to 640 (24 residues), see Phobius details PF00005: ABC_tran" amino acids 25 to 173 (149 residues), 110.5 bits, see alignment E=2.1e-35 PF12704: MacB_PCD" amino acids 281 to 499 (219 residues), 149.9 bits, see alignment E=2.5e-47 PF02687: FtsX" amino acids 536 to 650 (115 residues), 75.8 bits, see alignment E=6e-25

Best Hits

Swiss-Prot: 64% identical to MACB_VIBPA: Macrolide export ATP-binding/permease protein MacB (macB) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K05685, macrolide transport system ATP-binding/permease protein [EC: 3.6.3.-] (inferred from 100% identity to hse:Hsero_2045)

Predicted SEED Role

"Macrolide export ATP-binding/permease protein MacB (EC 3.6.3.-)" in subsystem Multidrug Resistance Efflux Pumps (EC 3.6.3.-)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ISY6 at UniProt or InterPro

Protein Sequence (657 amino acids)

>HSERO_RS10240 macrolide ABC transporter ATP-binding protein (Herbaspirillum seropedicae SmR1)
MRTPLLQLRGLRRDFPAGDEKITVLNDVNLDIHAGELVAIVGASGSGKSTLMNILGCLDK
PSAGSYLVAGRETGKLDADELAQLRREHFGFIFQRYHLLSDLDATANVEVPSVYAGLEPL
QRRQRAGELLARLGLAERSHHKPGQLSGGQQQRVSIARALMNGGDVILADEPTGALDSHS
GQEVIKILKELHAEGHTIIIVTHDMQVASHAQRIIEIKDGVIIADRRNEETVPALATTAS
NNTGASARQGRQARPWRAWLDRFKEALRMSLLAMNAHRLRSFLTMLGIIIGIASVVSVVA
LGSGSREQILADISAMGTNTIDIFPGADFGDMKSASIRTLTPADAAALAEQNFVDSVTPS
VATSSSARYGNISVTATINGVGEQYFRVRGLKMAQGKSFDTEGIRRYAQEVVIDANSYKK
LFPDGGNALGEVIFLGSVPCRIIGVTQKRENGFGNNNALNVWVPYTTAMSRVIGQRHLSG
ITVRVNDQVPSAAAEQGIVELMTLRHRTKDFYLFNTDSIRQTVEKATATLTLLVSMIALI
SLVVGGIGVMNIMLVSVTERTREIGVRMAVGARQSDIMQQFLIEAVLVCLAGGLLGVLLA
LSFGALFSHFVSSFRMIYSTASIVSAFACSTLIGVVFGFLPARNAARLNPVDALARE