Protein Info for HSERO_RS10225 in Herbaspirillum seropedicae SmR1

Annotation: flagellar hook protein FlgK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 778 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR02492: flagellar hook-associated protein FlgK" amino acids 5 to 353 (349 residues), 256.3 bits, see alignment E=3.7e-80 PF21158: flgK_1st_1" amino acids 343 to 399 (57 residues), 49.5 bits, see alignment 5.4e-17 PF21159: FlgK_2nd" amino acids 567 to 669 (103 residues), 28.5 bits, see alignment E=2.6e-10 PF06429: Flg_bbr_C" amino acids 722 to 775 (54 residues), 37.7 bits, see alignment 2.6e-13

Best Hits

KEGG orthology group: K02396, flagellar hook-associated protein 1 FlgK (inferred from 100% identity to hse:Hsero_2042)

Predicted SEED Role

"Flagellar hook-associated protein FlgK" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ISY3 at UniProt or InterPro

Protein Sequence (778 amino acids)

>HSERO_RS10225 flagellar hook protein FlgK (Herbaspirillum seropedicae SmR1)
MATNIFSIGQSALQAAMAAQATTSHNISNGKTPGYNRQEVVQSSAGGINYGYGFVGQGTQ
VNEIKRVYNDFLNKQALASQTSASSLDSYYSEISQINNMVADTKAGLSPALQDFFSAVQN
LASNPNTQASRQSVLSQASTLVARISSINDQLSSSSASVNSQITSTVTSINSFAQQISQL
NQAIVKAIGTGGGQPPNDLLDQRDQVISQLNKLVKITTVPQDTGSVSVFIGTGQSLVAGD
NVTQMVVTNSPTDVSRLQIGQAIPGGGTSTIPDSFFYDGGSLGGLLKYRSETLDPTQNAL
GRIAIAMGTAFNQQQKLGLDQNGNQGTALFNVSSPNLIGYPGNTGTTNLTTTITDPSALT
TSDYTLSYDGTNYTFTRLSDNTKTIKAPGAFPVTLDGVTYSNGAAAPGPFAPTMAAGNTY
KIQPTANGAAGFSLALNNTQLLATAAPIATSINATNNVNASMPASNTGNAIISNTSLDSS
QYQQGSSVSFTAALDASTPPKMQLSAAWTGAAPVPGVTVNYADGTTASVTGATPFDYKSG
MTITSGGVTYALTGSPAAGDKFNFAPVSANKGTATISTGSVTPAYLTTTTPLTKPTTLTY
NSTAAPPVFNISPAVPAGGGTITHKDGTTTTIAGGATTLSYTAGDSYEISGVQFAISGQP
GNGDQFTIAANTNAASDNRNALAMGKLQTANTINGTSFQGSYSQLVATIGNKTNEINVTN
TAEKARLTAIQNQQQSESGVNQDEELAHMIQNQQQYQAAAKIIQAASDMINVLLSLGS