Protein Info for HSERO_RS10145 in Herbaspirillum seropedicae SmR1

Annotation: flagellar biosynthesis protein FlhA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 705 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 117 to 140 (24 residues), see Phobius details amino acids 209 to 230 (22 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details amino acids 310 to 327 (18 residues), see Phobius details TIGR01398: flagellar biosynthesis protein FlhA" amino acids 21 to 700 (680 residues), 906.8 bits, see alignment E=4e-277 PF00771: FHIPEP" amino acids 31 to 692 (662 residues), 915.2 bits, see alignment E=1.3e-279

Best Hits

Swiss-Prot: 46% identical to FLHA_CAUVC: Flagellar biosynthesis protein FlhA (flhA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02400, flagellar biosynthesis protein FlhA (inferred from 100% identity to hse:Hsero_2026)

Predicted SEED Role

"Flagellar biosynthesis protein FlhA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ISI2 at UniProt or InterPro

Protein Sequence (705 amino acids)

>HSERO_RS10145 flagellar biosynthesis protein FlhA (Herbaspirillum seropedicae SmR1)
MATKLNTMKIPAWVPVKNARAMAAPILIVMMLAMMVLPLPAFMLDLLFSFNISLSVIVLM
TALYTVKPLDFIAFPAVLLVSTMLRLSLNVASTRVVLTEGHTGPDAAGKVIEAFGHFLIG
GNYTVGIVVFVILTIINFMVVTKGAGRIAEVGARFTLDAMPGKQMAIDADLNAGLIGEPE
ARARRKEVAQESEFYGAMDGASKYVRGDAVAGIIVTVVNIVGGLVVGMVQHDLAFDAALK
NYTLLAIGDGLVAQIPSLIISTAAGVVVSRVANDQDVGGQLINQLFAKPEVLYITAVIIG
GMGLIPGMPHIAFILLAAAMGGGAYAISKRVEKAKTEAAASQAQAAAGGGAAAAPQESEE
ATWNDVMPVDTLGLEVGYRLIPLVDKGQGGELLKRIKGIRKKFAQEVGFLSPPIHIRDNL
ELKPSAYRITLKGVEVGNGEAHAGQYLAINPGMVTGPLPGMMTTDPAFGLPAVWIDNGLR
EQASTMGYTVVDAGTVVATHLNHLITTHAAELLGRQEVQSLLDHLAKDAPKLVEDLVPKM
LPLGSLQKVLQNLLIEGVHIRDMRTIIETLAEHAARIQDPTDLTAIVRIALGRAIVQQMF
PGESELPVMALDSKLERLLMQALQASGESGGIEPGLADSLVQHTEIAAQRQEQMGYSPVL
LVGAPLRTLLARFLRRAMPQLRVLSHAEVPESKTIKVTSLVGGQA