Protein Info for HSERO_RS10100 in Herbaspirillum seropedicae SmR1

Annotation: cation transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 26 to 46 (21 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 199 to 224 (26 residues), see Phobius details amino acids 230 to 247 (18 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 22 to 298 (277 residues), 202.3 bits, see alignment E=5e-64 PF01545: Cation_efflux" amino acids 29 to 255 (227 residues), 114.6 bits, see alignment E=2.5e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_2017)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ISH3 at UniProt or InterPro

Protein Sequence (329 amino acids)

>HSERO_RS10100 cation transporter (Herbaspirillum seropedicae SmR1)
MQSTSPFRHEHVYLGANHDRNTRRTLWVVVLTAVMMVAEIAAGYLTGSMALLADGFHMAT
HTGALAIAAGAYVFARRHAHDQRFSFGTGKVGDLAGFASALVLAVIAIGIGGGSLWRLAS
PSPVEFGEAIVIAVIGLMVNIASALLLMEGHHHDHAHHDAHAHHAHHTHHTHHSDHGHGK
DHPPHHHAHAHDNNLRSAYLHVVADALTSVLAIAALLAGLYLGWTWLDPAMGVVGAVVIA
RWSYSLLRASATVLLDVTDEQVATRIRQALADEPVQIDDLHVWRIGPTARAAIVSLSGPA
EQEETPLRQKLAALEQLQHLSLEYRRLPA