Protein Info for HSERO_RS10055 in Herbaspirillum seropedicae SmR1

Annotation: glycerate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02595: Gly_kinase
  • amino acids 13 to 381 (369 residues), 411.2 bits, E=1.9e-127
• TIGR00045: glycerate kinase
  • amino acids 13 to 381 (369 residues), 369.8 bits, E=7.8e-115

Best Hits

Swiss-Prot: 43% identical to GLXK2_ECOLI: Glycerate 3-kinase (glxK) from Escherichia coli (strain K12)

KEGG orthology group: K00865, glycerate kinase [EC: 2.7.1.31] (inferred from 100% identity to hse:Hsero_2012)

MetaCyc: 43% identical to glycerate 2-kinase 2 (Escherichia coli K-12 substr. MG1655)
GKI-RXN [EC: 2.7.1.165]

Predicted SEED Role

"Glycerate kinase (EC 2.7.1.31)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Glycine and Serine Utilization or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle (EC 2.7.1.31)

MetaCyc Pathways

• superpathway of D-glucarate and D-galactarate degradation (5/5 steps found)
• D-glucarate degradation I (4/4 steps found)
• D-galactarate degradation I (4/4 steps found)
• glycolate and glyoxylate degradation I (3/4 steps found)
• superpathway of glycol metabolism and degradation (5/7 steps found)
• 2-O-α-mannosyl-D-glycerate degradation (1/2 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (6/9 steps found)
• photorespiration II (6/10 steps found)
• formaldehyde assimilation I (serine pathway) (8/13 steps found)
• photorespiration I (5/9 steps found)
• photorespiration III (5/9 steps found)
• 2-deoxy-D-ribose degradation II (4/8 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (16/31 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Glycine, serine and threonine metabolism
• Glyoxylate and dicarboxylate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.165 or 2.7.1.31

Sequence Analysis Tools

See D8ISG9 at UniProt or InterPro

Protein Sequence (387 amino acids)

>HSERO_RS10055 glycerate kinase (Herbaspirillum seropedicae SmR1)
MTSSRPALRPPVVVIAPDSFKGSLSAEDVARAIGAGIQAAIPDAEIRLRPIADGGEGTLD
ALMHAGGERFAVACRNAAGQMTEALVGILKDGSAVVESAAIVGLTDTAGTAVAVERRSTL
GVGDAIKALLDRGARSFLVALGGSSTNDGGAGLLAALGVVFYDAAGVEVAPAPAELHRVV
RVDASGLDARVKEAHFVAMSDVDNPLCGAEGATAVFGPQKGVQPDQVAPLDQTLAHFAQV
LEEALGRQAATLPGAGAAGGLGYALLMLGAQFRSGAQTVADHIGLDQALTGADWLITGEG
RSDAQTLHGKAPFIASQRARQLGVPATLLSGGIDRHSLAQLQTSFSGCFSIVFGPGALQD
AIAQAPQLLQASAEQLARLWQSAAAMR