Protein Info for HSERO_RS10030 in Herbaspirillum seropedicae SmR1

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 71 to 88 (18 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 169 to 187 (19 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 8 to 290 (283 residues), 60.1 bits, see alignment E=1e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_2007)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ISG4 at UniProt or InterPro

Protein Sequence (312 amino acids)

>HSERO_RS10030 acyltransferase (Herbaspirillum seropedicae SmR1)
MEKQHHGGLEILKLIMSLMVVGIHTNPFASLPALNSLTSNGIFRIAVPVFFVMNGYFLSL
ERDKFLPWLRRIVLLYLLLSLLFSPLWLDTASPQDALLSIVQNLATGWHHLWYLAALIVA
ACLAYLGRAHLSLLLPVALLCFVAGIVLQAIALWNGNDFAHAIHGQFDLYRNALTVALPF
LLIGMALRRRQTPLHVSLPLLLLVGALFVGEIVLWGWLSRNQTRDLYASLIVVAPVLFLA
ARQVQLNYRDHMSARIYYFHPIFEMAFKLNGKFGGGKVFLVTAVLSALLAYAIGKLKTLQ
GAGRLGWVRLIP