Protein Info for HSERO_RS09935 in Herbaspirillum seropedicae SmR1

Annotation: UDP-phosphate glucose phosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 41 to 57 (17 residues), see Phobius details amino acids 77 to 94 (18 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 276 to 300 (25 residues), see Phobius details amino acids 438 to 452 (15 residues), see Phobius details TIGR03023: undecaprenyl-phosphate glucose phosphotransferase" amino acids 21 to 461 (441 residues), 509.1 bits, see alignment E=1.5e-156 TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 22 to 461 (440 residues), 454.8 bits, see alignment E=4.1e-140 PF13727: CoA_binding_3" amino acids 70 to 235 (166 residues), 103.6 bits, see alignment E=1.3e-33 PF02397: Bac_transf" amino acids 271 to 456 (186 residues), 224 bits, see alignment E=1e-70

Best Hits

KEGG orthology group: K03606, putative colanic acid biosysnthesis UDP-glucose lipid carrier transferase (inferred from 100% identity to hse:Hsero_1988)

Predicted SEED Role

"capsular polysaccharide biosynthesis protein" in subsystem Rhamnose containing glycans

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ISE5 at UniProt or InterPro

Protein Sequence (461 amino acids)

>HSERO_RS09935 UDP-phosphate glucose phosphotransferase (Herbaspirillum seropedicae SmR1)
MVNVKPNVIVMVFKRLLEPAMIVAYLWVLVRLHGVPFSGDYWMLAIMAFFISSYFFTEFH
ERRLRRNPKGTRPVASIFVDWLAVVAVLGLIGYVCEFYQQFAPGVLAAWVIGTPVGLLVS
QYAQSRVMRDLHTKGEVSKAIIIGVNPAALKLAERMDNYPALMIKLMGFFDDREIGRQPQ
GTFTPLMGKMSDVAAYVRKHNINMVYISMPISAQPRVLQMIDELQDTTASIYFVPDIYIF
NLIQARFDYVGGMAVMAICETPFTGMNNFVKRVSDILLATVILLMLLPVLVVIAICVKAT
SPGPVIFKQRRYGLDGEEIVVYKFRSMTVLEDGANVQQATKGDARLTKIGGFLRKSSLDE
LPQFVNVLQGRMSIVGPRPHAVAHNELYRKQIKGYMLRHKVKPGITGWAQVNGLRGETET
LDKMKARIEFDLEYLRRWSLTFDLWIIVQTVRLVLKRENAY