Protein Info for HSERO_RS09620 in Herbaspirillum seropedicae SmR1

Annotation: flagellar hook-length control protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 transmembrane" amino acids 14 to 38 (25 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details PF07254: Cpta_toxin" amino acids 6 to 152 (147 residues), 37.3 bits, see alignment E=1.4e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1928)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IS92 at UniProt or InterPro

Protein Sequence (166 amino acids)

>HSERO_RS09620 flagellar hook-length control protein (Herbaspirillum seropedicae SmR1)
MSIAVSADIKPSRLLLLVTGFACLCVALTGVLLCVWLPGSWSWPARIALALACIIAAGVA
LLTVLRERKTIWLHISGTGQIRVVEHLLAASSRTKPQVMSAGLAQLLAGSTIWPGMLFLR
LRLESGKTRTIPVLSDSVSEDTFRALSVACRWLISHNTAKARMLEK