Protein Info for HSERO_RS09500 in Herbaspirillum seropedicae SmR1

Annotation: cell division protein FtsK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 780 transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 177 to 200 (24 residues), see Phobius details PF13491: FtsK_4TM" amino acids 25 to 206 (182 residues), 160.8 bits, see alignment E=5.4e-51 PF17854: FtsK_alpha" amino acids 284 to 384 (101 residues), 106.6 bits, see alignment E=1.3e-34 PF01580: FtsK_SpoIIIE" amino acids 392 to 601 (210 residues), 253.9 bits, see alignment E=2.4e-79 PF09397: FtsK_gamma" amino acids 711 to 771 (61 residues), 91 bits, see alignment 6.2e-30

Best Hits

KEGG orthology group: K03466, DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family (inferred from 100% identity to hse:Hsero_1903)

Predicted SEED Role

"Cell division protein FtsK" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton or Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IS68 at UniProt or InterPro

Protein Sequence (780 amino acids)

>HSERO_RS09500 cell division protein FtsK (Herbaspirillum seropedicae SmR1)
MSKTSQAHIRNTKAPAPPMPSRLVRLLSEARWLALSALLVYLVLILLSYSKTDPGWSVAS
SVPRVGNWGGRVGAWMADLMLYIFGLSAWWWCVLAARSVWTGYRRLSNRFLVAQPVEPEH
QQEPLIRAVGFVFMLTGSMGIEFTRMHRFAPKLPHSSGGVLGEMIGSAVQPTFGFTGSTL
LLLMLFGLGFSLLFHVSWLAAVERIGGLIEDGLFWVRDFFAARADRKAGQEAAVKREETV
VQERAKIVEAPPIRIEPQIVEVQKSDRVQKEKQTSLFDDVSTDLPPLSLLDEAPPSQQTV
SVETLEFTSRLIEKKLSDFGVEVKVVAAYPGPVITRYEIEPATGVKGSQIVNLARDLARS
LSLTSIRVVEVIQGKNYMGLELPNPKRQIVRLTEILGSKVYNDSHSSLTVALGKDIAGNP
VVADLAKMPHLLVAGTTGSGKSVGINATILSLLYKSTPRQVRLILIDPKMLELSIYEGIP
HLLAPVVTDMRQAGHALNWAVEEMERRYKKMSKLGVRNLAGYNQKIADAEKRGEKIPNPF
SLTPDAPEPLEQLETIVIIIDELADLMMVVGKKVEELIARIAQKARAAGIHLILATQRPS
VDVITGLIKANVPTRIAFQVSSKIDSRTILDQMGAETLLGMGDMLYNPPGTGLPVRVHGA
FVSDDEVHRVVEHLKSQGEPNYIEGILEGGVLEDADGGGSGAAAGGAGGGEGDEMYDQAV
AVVLKHRRASISLVQRHLRIGYNRAARLLEQMEQSGLVSTMQSNGNREILVPAGASDAAE