Protein Info for HSERO_RS09445 in Herbaspirillum seropedicae SmR1

Annotation: iron deficiency-induced protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF01547: SBP_bac_1" amino acids 36 to 288 (253 residues), 62.1 bits, see alignment E=1.9e-20 PF13531: SBP_bac_11" amino acids 38 to 292 (255 residues), 46.5 bits, see alignment E=8.3e-16 PF13416: SBP_bac_8" amino acids 39 to 307 (269 residues), 86.2 bits, see alignment E=6.7e-28 PF13343: SBP_bac_6" amino acids 74 to 310 (237 residues), 60.8 bits, see alignment E=2.9e-20

Best Hits

Swiss-Prot: 48% identical to FUTA1_SYNY3: Iron uptake protein A1 (futA1) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 100% identity to hse:Hsero_1892)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IS57 at UniProt or InterPro

Protein Sequence (344 amino acids)

>HSERO_RS09445 iron deficiency-induced protein A (Herbaspirillum seropedicae SmR1)
MFPRHLAVGAMLAAIATSSFAQEKVINLYSARHYQTDEALYADFTKTTGIKINRIDGDDA
GILARLKSEGASSPADVILLVDAARLWKAQSDGLFQPVKSKLLDERIPANLHSKEGSDGT
LWFGFSTRARVIVYNKASVKPEDVDTYEALGDPKNKGKLCTRSGSHPYNVSLFGALLEHD
GAAKTESILKGMVANQARQPVGGDTDQIKAVGSGECGVAISNSYYVARLMRSTKPEDVAL
MEKVGIVWPNQKSYGAHVNIAGGGVAKHAPHKAEAVQFLEYLASDSAQRYFAEGNNEWPA
VKSVKTENPALVKMGPFKAEVINIGAVGANQQKVLQMLDRVGYK