Protein Info for HSERO_RS09265 in Herbaspirillum seropedicae SmR1

Annotation: peptidase C69

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 250 to 270 (21 residues), see Phobius details PF01523: PmbA_TldD_1st" amino acids 33 to 100 (68 residues), 47.5 bits, see alignment E=2.5e-16 PF19290: PmbA_TldD_2nd" amino acids 128 to 234 (107 residues), 71.9 bits, see alignment E=9.5e-24 PF19289: PmbA_TldD_3rd" amino acids 241 to 453 (213 residues), 240.9 bits, see alignment E=1.4e-75

Best Hits

Swiss-Prot: 46% identical to PMBA_HAEIN: Metalloprotease PmbA homolog (pmbA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03592, PmbA protein (inferred from 100% identity to hse:Hsero_1857)

Predicted SEED Role

"TldE protein, part of TldE/TldD proteolytic complex"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IRP3 at UniProt or InterPro

Protein Sequence (454 amino acids)

>HSERO_RS09265 peptidase C69 (Herbaspirillum seropedicae SmR1)
MSDTPFTHSQDQLKQLAQDVLRYARDKGASDAAVDISEGSGLSVAVRKGKIETIEQNKDK
GIGVTVFLGEGRQVRRGNASTSDFSQQALKETVEAAYNIARFTSIDDCAGLPDAEMLEMA
PRDLKLFSPWNISAEEAVALAQRCETAALETDPRISNSEGAGVYVQHSHFIAANSRGFMG
GYPFSRHTISVAPIAGKGASMQRDDWYSSKRDPKKLAQPEAIGRYAAERALARLNARKLS
TRKCPVLFEAPLAAGLLGAFVQAVSGGALYRKSTFLLDSLGQQVFPEHIQILEDPHVIGG
VGSAPFDEEGVRTLKREVVRNGVVQGYFLSTYSARKLGMQTTGNSGGSHNLTLRSELTTR
ADTFKGMLKKMGTGLLVTELMGQGVNYVTGDYSRGASGYWVENGVIQYPVEEITIAGNMK
DMLRQIVAVGNDTLIRGTKETGSILLESMTIAGD