Protein Info for HSERO_RS08915 in Herbaspirillum seropedicae SmR1

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 42 to 59 (18 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 98 to 115 (18 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 183 to 200 (18 residues), see Phobius details amino acids 206 to 228 (23 residues), see Phobius details amino acids 231 to 258 (28 residues), see Phobius details amino acids 261 to 261 (1 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 280 (273 residues), 117.5 bits, see alignment E=3.1e-38

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to hse:Hsero_1786)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IRH4 at UniProt or InterPro

Protein Sequence (296 amino acids)

>HSERO_RS08915 ABC transporter permease (Herbaspirillum seropedicae SmR1)
MDILLQLVFSGIALGMIYAVIAFGYQLTFATSGTLNFGQGEALMLGALVGLSVVGNIHGG
PYLNYWLMIPIVLVFGALQGMFVEWIGVRPAIKIKSEFGWIMSTIALAIIFKNVAENIWG
KDDLPFPSPISGAPFQIFGANVQPMQVLVVVGALLIMAAVELFNRKSIYGKAVVATSNDR
DAAGLMGINTSMVITFSYALSSATAAFAGVLVAPLTLTGATMGAALGLKAFAVAIIGGLT
SGMGAIVGGLILGVAETLTGFYISTGYKEVPGLVLLLLVLAVKPAGLFGKTAIKKV