Protein Info for HSERO_RS08900 in Herbaspirillum seropedicae SmR1

Annotation: dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 PF00890: FAD_binding_2" amino acids 20 to 63 (44 residues), 22.9 bits, see alignment 1.4e-08 PF13450: NAD_binding_8" amino acids 23 to 68 (46 residues), 27.7 bits, see alignment 8e-10 PF21162: ETFQO_UQ-bd" amino acids 222 to 315 (94 residues), 149.9 bits, see alignment E=7.5e-48 PF05187: ETF_QO" amino acids 454 to 556 (103 residues), 174.2 bits, see alignment E=1.9e-55

Best Hits

Swiss-Prot: 63% identical to ETFD_PSEAE: Electron transfer flavoprotein-ubiquinone oxidoreductase (PA2953) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00311, electron-transferring-flavoprotein dehydrogenase [EC: 1.5.5.1] (inferred from 100% identity to hse:Hsero_1783)

MetaCyc: 58% identical to electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial (Homo sapiens)
Electron-transferring-flavoprotein dehydrogenase. [EC: 1.5.5.1]

Predicted SEED Role

"Electron transfer flavoprotein-ubiquinone oxidoreductase (EC 1.5.5.1)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases (EC 1.5.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IRH1 at UniProt or InterPro

Protein Sequence (558 amino acids)

>HSERO_RS08900 dehydrogenase (Herbaspirillum seropedicae SmR1)
MTSSQDLIAQYGPRESMEYDVVVVGGGPAGLSAAIRLKQLAAQQNREVSVCVLEKGSEVG
AHILSGAVMDPRALSELIPDWKEQGAPLNTPVTEDRFLFLSASKAYKTPNWLLPTCFQNH
GNYVISLSNVTRWLGQQAEALGVEIFPGFPAAEVLYHEDGSVKGVATGNMGINKEGEPGP
EFQLGMELHAKYTFFAEGARGHLGKQLISKYQLDAGRDPQTYAIGIKELWEVKPEVHQPG
LVVHTAGWPLDNDTYGGSFLYHLENNQVAVGYVVGLAYENPYLSPFEEFQRYKTHPEIRK
FFEGGKRLSYGARAITAGGVQSLPKLVFPGGALLGCDAGFLNASRIKGSHAAIKSGMLAA
DAAFHALGENRQSDELSAYPAAFEASWLKEELHKARNFKPSMSKGLVTGTLLVGIDQVLF
GGKAPWTLRHSHADHECLKPASNYAPIAYPKPDGKLTFDRLSSVFISNTNHGEDQPAHLT
LKDKNVPVQVNLAKYAGPESRYCPAGVYEFVKNEDNTDRLQINAQNCVHCKTCDIKDPTQ
NIVWVTPEGGGGPNYSGM