Protein Info for HSERO_RS08770 in Herbaspirillum seropedicae SmR1

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 55 (18 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 106 to 129 (24 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 219 to 260 (42 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details amino acids 306 to 327 (22 residues), see Phobius details PF06166: DUF979" amino acids 9 to 327 (319 residues), 403 bits, see alignment E=4.3e-125

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1758)

Predicted SEED Role

"FIG001614: Membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IRE7 at UniProt or InterPro

Protein Sequence (328 amino acids)

>HSERO_RS08770 membrane protein (Herbaspirillum seropedicae SmR1)
MNTLISINRIYYLIGIIVMMLTVMTLRDKGNPKRFTTALFWFLFGAVFLFGDLLVENLGK
SMAHRIIGGTVIIISLIAGTGLLSMGSYATSTHEERVASSKRLGNWLFFPAVLIPVITVA
CTVLLKGVSVGGVMLLDQKQLTLAALCVACVCALIAGCVLTRGTPLQAVRQSRRLVDSIG
WAAILPLMLAMLGGVFVAAKTGTSVQQVVSLFVNPDNRFLVVVIYCVGMALFTMVMGNAF
AAFPVMSAGIALPFLILGHHADPAPLVAIGMYSGYCGTLMTPMAANYNIVPAALLELKNK
YQVIKVQIPTALTLLTVNVFLMYFLAFR